KEGG   Tupaia chinensis (Chinese tree shrew): 102478615
Entry
102478615         CDS       T02978                                 

Gene name
IL2
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04060  Cytokine-cytokine receptor interaction
tup04061  Viral protein interaction with cytokine and cytokine receptor
tup04151  PI3K-Akt signaling pathway
tup04625  C-type lectin receptor signaling pathway
tup04630  JAK-STAT signaling pathway
tup04658  Th1 and Th2 cell differentiation
tup04659  Th17 cell differentiation
tup04660  T cell receptor signaling pathway
tup04672  Intestinal immune network for IgA production
tup04940  Type I diabetes mellitus
tup05135  Yersinia infection
tup05142  Chagas disease
tup05162  Measles
tup05166  Human T-cell leukemia virus 1 infection
tup05200  Pathways in cancer
tup05320  Autoimmune thyroid disease
tup05321  Inflammatory bowel disease
tup05330  Allograft rejection
tup05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102478615 (IL2)
   04151 PI3K-Akt signaling pathway
    102478615 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102478615 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102478615 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102478615 (IL2)
   04660 T cell receptor signaling pathway
    102478615 (IL2)
   04658 Th1 and Th2 cell differentiation
    102478615 (IL2)
   04659 Th17 cell differentiation
    102478615 (IL2)
   04672 Intestinal immune network for IgA production
    102478615 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102478615 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102478615 (IL2)
   05321 Inflammatory bowel disease
    102478615 (IL2)
   05330 Allograft rejection
    102478615 (IL2)
   05332 Graft-versus-host disease
    102478615 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102478615 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102478615 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102478615 (IL2)
   05162 Measles
    102478615 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102478615 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tup04052]
    102478615 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:tup00536]
    102478615 (IL2)
Cytokines and growth factors [BR:tup04052]
 Cytokines
  Interleukins
   102478615 (IL2)
Glycosaminoglycan binding proteins [BR:tup00536]
 Heparan sulfate / Haparin
  Cytokines
   102478615 (IL2)
SSDB
Motif
Pfam: IL2
Other DBs
NCBI-GeneID: 102478615
NCBI-ProteinID: XP_006153185
LinkDB
Position
Un
AA seq 154 aa
MHKMQLLSCIAFTLVLVTNSAPTSSSTVDTKEPLEHLLLDLQKILNGINNYKNPKMLSRM
LTFKFYTPRKATELKHLQCLEEELKPLEKVLNLAQSKNFHLKDTRQLISNINVTVLELKG
SETSVCEYEDRVATIVEFLNMWITFCQSIISTLS
NT seq 465 nt   +upstreamnt  +downstreamnt
atgcacaaaatgcaactcttgtcttgcattgccttcactcttgtcctcgtcacaaacagt
gcacctacttcgagctctaccgtggatacaaaggaaccactggagcacttactgctggat
ttacagaagattttgaatggaattaataattacaagaacccaaagatgctctccaggatg
ctcacatttaaattttatacacccagaaaggccacagaattgaaacatcttcagtgtcta
gaagaagaactcaaacctctggagaaagtgctaaatttagctcaaagcaaaaactttcac
ttaaaagataccaggcaattaatcagcaacatcaatgtaacagttctggaattgaagggc
tctgaaacatccgtgtgtgaatatgaagacagggtagcaactatcgtggaatttctgaat
atgtggattaccttctgtcaaagcatcatttcaacactgagttga

DBGET integrated database retrieval system