KEGG   Tupaia chinensis (Chinese tree shrew): 102479102
Entry
102479102         CDS       T02978                                 

Gene name
RAC1
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04010  MAPK signaling pathway
tup04014  Ras signaling pathway
tup04015  Rap1 signaling pathway
tup04024  cAMP signaling pathway
tup04062  Chemokine signaling pathway
tup04071  Sphingolipid signaling pathway
tup04145  Phagosome
tup04151  PI3K-Akt signaling pathway
tup04310  Wnt signaling pathway
tup04360  Axon guidance
tup04370  VEGF signaling pathway
tup04380  Osteoclast differentiation
tup04510  Focal adhesion
tup04520  Adherens junction
tup04530  Tight junction
tup04620  Toll-like receptor signaling pathway
tup04650  Natural killer cell mediated cytotoxicity
tup04662  B cell receptor signaling pathway
tup04664  Fc epsilon RI signaling pathway
tup04666  Fc gamma R-mediated phagocytosis
tup04670  Leukocyte transendothelial migration
tup04722  Neurotrophin signaling pathway
tup04810  Regulation of actin cytoskeleton
tup04932  Non-alcoholic fatty liver disease
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup04972  Pancreatic secretion
tup05014  Amyotrophic lateral sclerosis
tup05020  Prion disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05100  Bacterial invasion of epithelial cells
tup05132  Salmonella infection
tup05135  Yersinia infection
tup05163  Human cytomegalovirus infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05169  Epstein-Barr virus infection
tup05170  Human immunodeficiency virus 1 infection
tup05200  Pathways in cancer
tup05203  Viral carcinogenesis
tup05205  Proteoglycans in cancer
tup05210  Colorectal cancer
tup05211  Renal cell carcinoma
tup05212  Pancreatic cancer
tup05231  Choline metabolism in cancer
tup05416  Viral myocarditis
tup05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102479102 (RAC1)
   04014 Ras signaling pathway
    102479102 (RAC1)
   04015 Rap1 signaling pathway
    102479102 (RAC1)
   04310 Wnt signaling pathway
    102479102 (RAC1)
   04370 VEGF signaling pathway
    102479102 (RAC1)
   04071 Sphingolipid signaling pathway
    102479102 (RAC1)
   04024 cAMP signaling pathway
    102479102 (RAC1)
   04151 PI3K-Akt signaling pathway
    102479102 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102479102 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102479102 (RAC1)
   04520 Adherens junction
    102479102 (RAC1)
   04530 Tight junction
    102479102 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102479102 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102479102 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    102479102 (RAC1)
   04662 B cell receptor signaling pathway
    102479102 (RAC1)
   04664 Fc epsilon RI signaling pathway
    102479102 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    102479102 (RAC1)
   04670 Leukocyte transendothelial migration
    102479102 (RAC1)
   04062 Chemokine signaling pathway
    102479102 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    102479102 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102479102 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    102479102 (RAC1)
   04380 Osteoclast differentiation
    102479102 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102479102 (RAC1)
   05205 Proteoglycans in cancer
    102479102 (RAC1)
   05203 Viral carcinogenesis
    102479102 (RAC1)
   05231 Choline metabolism in cancer
    102479102 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102479102 (RAC1)
   05212 Pancreatic cancer
    102479102 (RAC1)
   05211 Renal cell carcinoma
    102479102 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102479102 (RAC1)
   05020 Prion disease
    102479102 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    102479102 (RAC1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102479102 (RAC1)
   05416 Viral myocarditis
    102479102 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102479102 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102479102 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102479102 (RAC1)
   05135 Yersinia infection
    102479102 (RAC1)
   05100 Bacterial invasion of epithelial cells
    102479102 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102479102 (RAC1)
   05163 Human cytomegalovirus infection
    102479102 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102479102 (RAC1)
   05169 Epstein-Barr virus infection
    102479102 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tup04131]
    102479102 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tup04147]
    102479102 (RAC1)
   04031 GTP-binding proteins [BR:tup04031]
    102479102 (RAC1)
Membrane trafficking [BR:tup04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    102479102 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    102479102 (RAC1)
  Macropinocytosis
   Ras GTPases
    102479102 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    102479102 (RAC1)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102479102 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   102479102 (RAC1)
  Exosomal proteins of colorectal cancer cells
   102479102 (RAC1)
  Exosomal proteins of bladder cancer cells
   102479102 (RAC1)
GTP-binding proteins [BR:tup04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    102479102 (RAC1)
SSDB
Motif
Pfam: Ras Roc CagD
Other DBs
NCBI-GeneID: 102479102
NCBI-ProteinID: XP_006143734
LinkDB
Position
Un
AA seq 285 aa
MYGLKFSTLKLLRPDFFDLYFATFGLLKSAIHQTPSYKGMDHIPNTLLTYRVTNPAHITI
PQERCKKWRIKFIGAWLLTEYLISARAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMV
DGKPVNLGLWDTAGQEDYDRLRPLSYPQTVGETYGKDITSRGKDKPIADVFLICFSLVSP
ASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAK
EIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
NT seq 858 nt   +upstreamnt  +downstreamnt
atgtacgggctgaagttctcgaccctgaagttactacgcccagatttcttcgacttgtac
ttcgctacttttgggctgcttaaatcagctattcatcaaacgccttcttacaagggtatg
gatcacatccccaacacactacttacttatagggtaactaaccctgcgcacatcactatc
ccccaagagaggtgcaagaagtggagaattaagttcataggtgcttggctccttactgag
tacttaataagtgccagagccgtaggtaaaacttgcctactgatcagttatacaaccaat
gccttccctggagaatatattcctactgtctttgataactattctgccaatgttatggta
gatggaaaaccggtgaatctgggcttatgggatacagctggacaagaagattatgacaga
ttacgtcccctatcctatccacaaacagttggagaaacctatggtaaggatataacctcc
agggggaaagacaagccaattgccgatgtattcttaatttgcttttcccttgtgagtcct
gcatcatttgaaaatgtccgtgcaaaatggtatcctgaagtacgacaccattgtcccaat
actcccatcattctagtgggaactaaacttgatcttcgagatgataaggacacgattgag
aaactgaaggaaaagaaactgactcccatcacctacccacagggtctagccatggctaag
gagatcggtgctgtaaaatacctggagtgctcagcgctcacacagcgaggcctcaagaca
gtgtttgatgaagctattcgagcagttctctgcccacctcctgtcaagaagaggaagaga
aaatgtctgctgttgtaa

DBGET integrated database retrieval system