KEGG   Tupaia chinensis (Chinese tree shrew): 102479454
Entry
102479454         CDS       T02978                                 

Gene name
POLK
Definition
(RefSeq) DNA polymerase kappa
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup03460  Fanconi anemia pathway
tup05169  Epstein-Barr virus infection
tup05200  Pathways in cancer
tup05202  Transcriptional misregulation in cancer
tup05210  Colorectal cancer
tup05212  Pancreatic cancer
tup05213  Endometrial cancer
tup05214  Glioma
tup05216  Thyroid cancer
tup05217  Basal cell carcinoma
tup05218  Melanoma
tup05220  Chronic myeloid leukemia
tup05222  Small cell lung cancer
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    102479454 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102479454 (POLK)
   05202 Transcriptional misregulation in cancer
    102479454 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102479454 (POLK)
   05212 Pancreatic cancer
    102479454 (POLK)
   05225 Hepatocellular carcinoma
    102479454 (POLK)
   05226 Gastric cancer
    102479454 (POLK)
   05214 Glioma
    102479454 (POLK)
   05216 Thyroid cancer
    102479454 (POLK)
   05220 Chronic myeloid leukemia
    102479454 (POLK)
   05217 Basal cell carcinoma
    102479454 (POLK)
   05218 Melanoma
    102479454 (POLK)
   05213 Endometrial cancer
    102479454 (POLK)
   05224 Breast cancer
    102479454 (POLK)
   05222 Small cell lung cancer
    102479454 (POLK)
   05223 Non-small cell lung cancer
    102479454 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102479454 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tup03400]
    102479454 (POLK)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     102479454 (POLK)
DNA repair and recombination proteins [BR:tup03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    102479454 (POLK)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH
Other DBs
NCBI-GeneID: 102479454
NCBI-ProteinID: XP_006167848
LinkDB
Position
Un
AA seq 867 aa
MDNTNEKNDNYKDDLLLRIGLNDNKAGMEGLDKEKINKIIMEATKGSKFYGNELKKEKQV
NQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLSNTIVHIDMDAFYAAVEMRDN
PELKEKPIAVGSMSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKQ
VKEILADYDPNFMAMSLDEAYLNITKHLQERQNWPEDRRYFIKMGNSVENDKPGKEVNKL
NDHEQSMSPLLFEDSPPDLQPPGNSLQENFEEQKYPEILQNSVVFGSSAEEVVKEIRFRI
EQKTSLTASAGIAPNTMLAKVCSDKNKPNGQYQILPDRQAVMDFIKDLPIRKVSGIGKVT
EKMLKALGIITCTDLYQQRALLSLLFSETSWHYFLHISLGLGSTHLARDGERKSMSVERT
FSEISKTEEQYSLCQELCSELAQDLQKEGLKGRTVTIKLKNVNFEVKTRASTVSSVISTA
EEIFAIAKELLRTEIDADFPHPLRLRLMGVRISGFPNEENKKHQQKSIIGFLQPGNQAPS
ATGCIMEKTDKDQFVKPLEMSHKKSFFDKKRSERKWNHQDTLKCETVNKQNLQTSQPFQV
LKKMSENLEASENSDSCQIFTCPVCFREQGSISLEAFNKHVDACLDGPSISENSKILSCS
HVSSTKINEKENVQYSFSLCAKQGYENHQKNTEITSVDCIDLVETVDNLPKAESIDALSS
KHSKEECSSLLSKSFNTEHCHQNSCTISSENKDIELTRQESPQPYLHEEVTGQALVCPVC
NLEQKTSDLTLFNVHVDVCLNKGIIQELRQDKVNPVNQPKESGSTGSSNRVQKNVTRPKR
SGLMTKYSASKKTKPNNPRHTLDVFFK
NT seq 2604 nt   +upstreamnt  +downstreamnt
atggataacacaaatgagaagaatgacaattacaaagatgatcttctgctcaggatagga
cttaatgacaataaagcaggaatggaaggattggataaagagaaaattaacaaaattata
atggaagccacaaaggggtccaaattttatggaaatgagctcaagaaagaaaagcaagtc
aaccaacgcattgaaaatatgatgcaacagaaagctcaaatcactagccagcagctaagg
aaagcacaattacaggtcgacagatttgcaatggaattagaacagagccgaaatttgagc
aatactatagtgcacattgacatggatgctttctacgcagctgtagaaatgagggacaat
ccagaattgaaggaaaaacccattgctgtaggatcaatgagcatgttgtctacctcaaat
taccatgcaaggaggtttggcgttcgtgcagccatgccaggatttattgctaagagactc
tgcccacaactaattatagtgcccccaaactttgacaaataccgagctgtgagtaaacag
gttaaggaaatacttgctgattatgatcccaactttatggccatgagtcttgacgaagcc
tacttgaatataacaaaacacttacaggaaagacaaaattggcccgaggacagaagatat
tttatcaaaatgggaaactctgtggaaaatgataaaccaggaaaagaagttaataaactg
aatgatcatgaacaatccatgtctccactacttttcgaagacagtcctcctgatttgcag
cctccaggaaattctttacaagagaactttgaagaacaaaaatatcctgaaatacttcaa
aactcagttgtttttggatcatcagctgaggaagtggtcaaggaaattcgtttcagaatt
gagcaaaaaacatcactgacagccagtgcaggcatcgccccaaatacaatgttagcaaaa
gtatgcagtgataagaataaaccaaatggacagtaccagattcttcctgacagacaagct
gtgatggacttcatcaaggacttacccattagaaaggtttctggaataggaaaagttaca
gagaaaatgttaaaggctcttggaattattacttgcacagacctctaccaacagagggca
ttactttctctcctcttctctgaaacatcttggcattatttccttcatatttccctgggt
ctaggttcaacacacctggcaagggatggagagaggaagagtatgagcgttgagaggaca
ttcagcgagataagtaaaacagaagaacagtacagcttgtgccaagaactttgcagtgaa
cttgctcaagatctgcagaaagaaggacttaagggtagaacggttaccattaagctaaag
aatgtgaattttgaagtaaaaactcgtgcatctacagtttcatctgttatttctactgca
gaagaaatatttgctattgctaaggagttgctaagaacggaaattgatgctgattttcca
catcccttgagattaagacttatgggtgttcgaatatctggttttccaaatgaagaaaat
aagaagcaccaacaaaagagcattattggcttcttacagcctggaaaccaagcgccgtca
gccactgggtgtataatggagaaaactgacaaagatcagttcgtaaaaccccttgaaatg
tctcataagaagagtttctttgataaaaaacgatcagaaaggaaatggaaccaccaagat
acattgaaatgtgaaactgtgaataaacaaaatttacagacatcacaaccattccaagtt
ttaaagaaaatgagtgagaatttagaagcatcggagaattcagatagttgtcagatattt
acctgtcctgtttgcttcagggagcaaggaagcatcagtctggaagcctttaataaacat
gtagatgcgtgtcttgatggaccttccatcagtgaaaactccaaaatactctcatgttca
catgtttcatctaccaaaattaatgagaaagaaaatgtacaatattctttctcactttgt
gcgaagcaaggttatgaaaaccatcagaaaaatacagaaatcacttcagtagattgtata
gatttggtagagactgtggataacttacccaaagcagaaagtatagatgctttaagtagt
aagcacagcaaagaggaatgttctagtcttctaagcaagtcttttaatactgaacactgt
catcagaattcttgtactatttcatcagaaaataaagacatcgagttaactaggcaagaa
tctccccagccttatttacacgaagaggtaacaggccaagctctagtttgtcctgtttgt
aacttagaacaaaagacttcagatcttaccctgttcaatgtgcacgtggatgtttgctta
aataaaggtattatccaagaactaagacaagataaagttaatccagttaatcaacccaaa
gaaagtggaagtactggtagctcaaacagagtacagaagaatgtaacaagaccaaagaga
tcaggactaatgacaaagtactcagcatcaaagaaaacaaaaccaaacaatcccagacac
acccttgatgtattttttaaatga

DBGET integrated database retrieval system