KEGG   Tupaia chinensis (Chinese tree shrew): 102479933Help
Entry
102479933         CDS       T02978                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00052  Galactose metabolism
tup00500  Starch and sucrose metabolism
tup01100  Metabolic pathways
tup04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102479933 (MGAM)
   00500 Starch and sucrose metabolism
    102479933 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102479933 (MGAM)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102479933 (MGAM)
    3.2.1.20  alpha-glucosidase
     102479933 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 LapA_dom
Motif
Other DBs
NCBI-GeneID: 102479933
NCBI-ProteinID: XP_014441942
LinkDB All DBs
Position
Un
AA seq 1763 aa AA seqDB search
MARKKLKRFTTLEVTLSVLLLVVFIIALVLIVLLATGSKDSKDSETTGTPTPGTSTTPDS
AKCPVVNELERINCIPEQSPTKAVCDQRGCCWSPQVPVNIPWCYYSKNHGYQIEGDIANT
NAGFTAQLRSLSSSSPFGNDVDIVLLTAEYQTSNRFHFKLTDQTKNRYEVPHEHVQPFTG
NAASSLTYEVEVSNQPFSIKVIRGSNKRVLFDSSIGPLLFSDQFLQLSIRLPSANVYGLG
EHVHQQYRHDMNWKTWPIFNRDTTPNGDGTNLYGAQTFFLCLEDASGSSFGVFLMNSNAM
EVILQPTPAVTYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYDY
GTLENMKEVVERNRAAQLPYDVQHADIDYMDERKDFTYDPVAFSGLPEFVKELHNNGQKL
VIIVDPAISNNSSLSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGRTVFPDYTNPNCA
VWWTREFELFHNQVEFDGIWIDMNEVSNFVDGSISGCSANNLNNPPFTPNVLGGCLFCKS
LCMDAVQHWGKQYDVHNLYGYCMAIATAEAVKTVFPNKRSFIVTRSTFAGSGKFAAHWLG
DNTATWDDLRWSIPGMLEFNLFGIPLSQLLNSSRHYLNIRYTLLPYLYTLFYRAHNRGDT
VARPLLHEFYSDNSTWDVHRQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGAQLR
WRKEEKELELPGDKIGLHLRGGYIFPTQQPNTTTMARYNVDTVANGIYLLCEFSVTQNRL
DVKILQSAYKDPNNLTFKEIKILGTQEFRSVTVKHNGVPSQMSPRVSYDSNLKVAIITEI
DLVLGEAYTVEWSMILRDEEKIDCYPDEQGASADSCAARGCVWEESSTPGVPFCYFVSDL
YSVSNVQYNSHGATADISLKSSVYANALPSTPVNSLRLDVTYHKNEMLQFKIYDPNNKRY
EVPIPLNIPRVPTSTSQDQLYDVLIKQNPFGIEIRRKSTNTVIWDSQLLGFTFNDMFIRI
STRLPSEYIYGFGETEHTAFKRDLNWHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGNA
HGVLLLNSNAMDVTFQPLPALTYRTTGGILDFYVLLGPTPELVTQQYTELIGRPVMVPYW
SLGFQLCRYGYQNDSEIANLYDDMVAAQIPYDVQYSDIDYMERQLDFTLSPKFAGFPALI
NRMKSEGMRVILILDPAISGNETEPYPAFTRGVADDVFIRYPNGGDIVWGKVWPDFPGIV
VNGSLDWDSQVEQYRAYVAFPDFFRNSTANWWKREMEELYTNPQQPERSLKYDGMWIDMN
EPSSFVNGAVPPGCKNATLNHPPYMPHLESRDRGLSSKTLCMESQQILPDGSLVRHYDVH
SLYGWSQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMM
EFSLFGISYTGADICGFFQDAEYEMCARWMQLGAFYPFSRNHNTIGTRRQDPVSWDANFV
NISKKVLQTRYTLLPYLYTLMHQAHTEGITVVRPLLHEFVTDRVTWDIDNQFLLGPAFLV
SPVLEPNARNVTAYFPRARWYDYYTGVDINTRGQWKALPAPLDHINLHVRGGYILPWQEP
ALNTHLSRQKFFGFKVALDDEGTAKGWLFWDDGQTIDTHGKGLYYLANFSVSQNVMESHV
ILNNYIVATNPLKLGYIEIWGVGSFPITSVSISASGTLITPTFIHSSVTQVLSIDLTKEN
LSLHNFNSLTWGSSLNFWDNIQP
NT seq 5292 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagttgaaacgttttaccactttggaggtgactctcagtgttctcctg
ctggtggtgtttatcatcgctctcgttctcatagtgcttttagccacaggttctaaggat
tctaaagattctgagaccactggtaccccgactcctgggacaagtaccacccctgattct
gccaagtgcccagtggtaaatgaattggaacgaataaactgcattcctgagcagtcacca
acaaaggccgtctgtgaccagcgcggctgctgctggagtcctcaggtacctgtaaacata
ccatggtgttactattccaagaatcatggctaccaaatagaaggtgacattgcaaacacc
aacgcaggattcacggcccagttgagaagtctgtcttcttcatccccatttggaaatgat
gtcgacattgtccttctcacagcagaatatcagacgtctaatcgctttcactttaagttg
actgaccaaaccaagaacaggtatgaagtgcctcatgaacatgtgcagccctttactgga
aacgctgcgtcttctttgacctatgaagttgaggtctccaaccagccatttagcatcaaa
gtgatcagaggaagcaacaagcgtgttctgtttgactcaagcatcgggcccctcctgttt
tctgatcagttcctgcagctgtccatccgcctgcccagtgcgaatgtgtatggcctggga
gaacacgtgcaccaacagtaccggcatgacatgaattggaagacctggcccatatttaac
agggacacaacccccaatggggatggaactaacttgtatggtgcacagacattcttcctg
tgccttgaagatgctagcggatcgtcctttggagtgtttctgatgaacagcaatgccatg
gaggttatcctccagcccacaccagcagtcacgtaccgcacaatcgggggcatccttgac
ttctatgtgttcttgggaaacacaccggagcaagttgttcaagaatatctagagctcatt
ggacggccagcccttccctcatattgggcacttggattccaccttagtcgctacgactat
ggaaccctagaaaacatgaaagaagttgtagagagaaaccgtgcagcacaactgccttat
gatgttcagcatgctgatattgattatatggatgagagaaaagacttcacttatgatcca
gtggcttttagtggcttacctgagttcgttaaggagttacacaataatggacagaaatta
gtcatcattgtggatccagccatctccaacaactcttctctgagtaaaccctacggcccg
tatgacaggggttcagacatgaagatatgggtgaatagttctgatggagtgactccactc
attggagaggtctggcctggaagaactgtttttcctgattacaccaatcccaactgtgca
gtttggtggacaagggaatttgagcttttccacaatcaagtggagtttgatggaatctgg
attgatatgaatgaagtctccaactttgttgatggttcaatttcaggatgttccgcaaac
aacctaaataatccaccattcactcccaatgtcctgggtggttgcctgttttgcaagagt
ctctgcatggatgccgtgcaacactggggcaagcagtatgacgtccacaatctgtatggc
tactgcatggcgattgccacagcagaagctgtcaagactgtgttccctaataagagaagc
ttcattgtgacccgttctacctttgcgggatctggcaagttcgcagcccattggttagga
gacaacacagccacatgggatgaccttcgatggtccatccctggcatgcttgagttcaac
ctttttggtatcccactgtcccagctgttgaattcctccagacactaccttaacatccgc
tatactcttctgccttacctctacaccctcttctaccgtgctcacaaccggggggacacg
gtggccaggccccttctacatgagttctacagtgacaacagcacttgggatgtgcatcgg
cagtttttatgggggccaggactcctcatcactccagttctggatgagggggcagagaaa
gtaatggcatatgtgccggatgctgtttggtacgactacgagactggggcccaactgaga
tggagaaaggaagaaaaggagctggaacttcctggagacaaaattggacttcaccttcga
ggaggctacatcttccccacacagcagccaaatacaaccactatggccaggtacaatgtg
gatactgtggccaatggaatttatcttctatgtgagttctctgtcacccaaaaccgcttg
gatgtgaagattttacaatcagcctacaaggaccccaataatttaacatttaaagagatt
aaaatccttgggactcaggaatttagaagtgttacagtgaaacacaatggtgtcccaagt
caaatgtctcctagagtctcttatgattctaatttgaaggttgccattatcacagaaatt
gatcttgtcctgggtgaagcatacacagtggagtggagcatgatcttaagagatgaagaa
aaaatagactgttatcctgatgaacagggtgcttctgcagacagctgtgctgcccgcggc
tgtgtctgggaggaatctagtactccgggggtcccgttctgctattttgttagtgatctg
tactctgtcagcaatgttcagtataactcacatggggccacagctgacatctccttgaag
tcttctgtttacgccaacgctctgccctccacacctgtgaactcactccgcctggacgtg
acctaccataagaatgaaatgctgcagtttaagatttatgaccctaacaacaagcggtat
gaagtccctatccctctgaacatacccagggttccaactagcacctcccaggatcaactc
tatgatgtcctcattaagcagaatccttttgggattgaaattcgccgaaagagtacaaac
actgtaatttgggactctcaactccttggcttcaccttcaatgacatgttcattcgcatc
tccacccgccttccctctgagtacatctatggctttggggaaactgagcacacagctttt
aagagggatttgaactggcacacatggggaatgttttcccgagaccaacccccagggtac
aagaagaattcatatggtgttcacccttactacatgggactggaggaggatgggaatgcc
cacggagtgctcctgctcaacagcaatgccatggatgtgacgttccagcctctgcctgct
ttgacataccgtactacaggcggtattctggacttttatgtgctcttggggccgactcca
gagcttgtcactcagcagtacactgagttgattggtcggcctgtgatggtaccttattgg
tcattggggttccagttgtgtcgctatggataccagaatgactccgagatcgctaacttg
tatgatgatatggtggctgcacagatcccttatgacgtgcagtactcggacatcgactac
atggagcggcagctggacttcaccctcagccccaagtttgctgggtttccagctctgatc
aaccgcatgaagtctgaaggcatgcgagtcatcctcattctggacccagccatttctggc
aatgagacagagccctatcctgccttcactcggggtgtggcggatgatgtcttcatcaga
tatccgaatggtggagacattgtctggggaaaggtctggcctgattttcctggtattgtc
gttaatgggtctctggactgggatagtcaagtagagcaataccgagcttatgtggccttc
ccagactttttccgcaattcaactgcaaactggtggaagagggaaatggaagaactgtac
accaacccacagcaaccagagaggagcttgaagtatgatggcatgtggattgatatgaat
gaaccatctagctttgtgaatggggcagttcctccaggctgcaaaaatgctactctgaac
catcctccctacatgccacatctggagtcgagagacaggggcctgagcagcaagaccctg
tgcatggagagccagcagatcttgcccgatggatccctggtgcggcactatgatgtgcac
agtctgtatgggtggtcccagaccagacccacatacgaagccgtgcaggaggtgacagga
cagcgaggcattgtcattacccgctccaccttcccctcttctggccgctgggcaggacac
tggctgggagacaacacggctgcatgggaccagctgaagaaatcaatcattggcatgatg
gagttcagcctctttggcatatcctatacaggagcagatatctgtgggttctttcaagat
gctgaatacgagatgtgtgcccgctggatgcaactaggagccttctatcccttctcaagg
aaccacaacactattggaaccaggagacaagaccctgtatcttgggatgctaactttgtg
aatatttccaagaaagtcctacagaccagatacactctgttgccatatctctacaccctg
atgcaccaggcccacactgagggcatcactgttgtgcggcctcttctccatgagttcgtg
acagaccgagtgacctgggatatagataatcagttcctgctgggcccagcctttctggtc
agccctgtcctggagcctaatgccagaaacgtcactgcatattttcctagagcccgctgg
tatgattactacacgggtgtggatattaacacaagaggacagtggaaggccttgccagcc
cctcttgaccacattaatcttcatgtccgtgggggctacatcctgccctggcaggaacct
gcactgaacacccatctaagtcgccagaaattcttcggcttcaaggttgccttggatgat
gagggaactgctaagggctggctcttctgggatgatggacagaccattgatacccatgga
aaaggactctattacttggccaacttctctgtcagccagaatgtaatggagagtcatgta
attttaaacaattacatcgtcgctacaaaccctttgaagctgggctacattgaaatctgg
ggagtgggaagtttccccattaccagtgtcagcatctctgcaagtggcacgcttataaca
cccaccttcatccacagctcagtaacacaggtgttgagcatcgacctgactaaggaaaac
ctcagcctacataatttcaattcactgacgtggggaagcagcctgaacttctgggacaat
atccagccatga

DBGET integrated database retrieval system