KEGG   Tupaia chinensis (Chinese tree shrew): 102480355Help
Entry
102480355         CDS       T02978                                 

Definition
(RefSeq) probable maltase-glucoamylase 2
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00052  Galactose metabolism
tup00500  Starch and sucrose metabolism
tup01100  Metabolic pathways
tup04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102480355
   00500 Starch and sucrose metabolism
    102480355
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102480355
Enzymes [BR:tup01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102480355
    3.2.1.20  alpha-glucosidase
     102480355
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102480355
NCBI-ProteinID: XP_014441943
LinkDB All DBs
Position
Un
AA seq 3154 aa AA seqDB search
MLLSAAHPRIAMARKLTVLEVLLIIYFLIVSVIDILLLFFVLEKTPPDSSFIPECPDISN
SERIDCAPGQVVTEEICRRYYKCCWKPLEDSNVPKCFFPRNWGYEVSDARTITSRGFSVK
LKRFPSPSLFGYDVNNTLFTAEYQTSNRFRFKITDDNNKRYEVPLTIKSGNETADTSNLN
YDIEVIDKPFSLKIMRRSNRRVLLDTGIGPLLYAQQYLQLSFRLPSTNVYGLGEHVHQQY
LHNMTWKTWPIFTRDATPTEDMINLYGAHTFFLCLEDTSGFSFGVFLMNSNAMEVTLQPA
PAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPFLPSYWSLGFQLSRRDYGGIDGLK
EVVSRTRKAGIPYDVQYSDIDYMDGKKDFTLNNAYLDLPAFAEELHDKGQKYVIILHPGI
SNTSGYQPYQNGNTKRVWILDGNGFAVGEGYPGPTVFPDYSNDECIQWWKEELTKFHTEL
AFDGVWIEMDELSSFRQRPGPECESNSLNFPPFTPRVLDRLLFSRTLCMDTEFQKGFHYD
IHSLYGYFMANATNSALESLFPNNRSFILSRSTFAGSGTVAAHWLGDNAATWNDLRWSIP
SILEFNLFGIPMVGANICGYSKDVTEELCRRWMQLGAFYPLSRNHNGPGFRDQDPAAFGE
DSLLLNSSRHYLNIRYTLLPYLYTLFYRAHTLGDTVARPLVHEFYQDPATWAIHEQFLWG
PGLLITPVLYEGVDHVKAYVPDAIWYDYETGVAMEQRKQWVDMLLPGDKMGLHLRGGYIF
PTQQPGTSTEVSRKNSLGLIVALDYKREGKGQLYWDDGVSRAAVTNYILYNFSVTSNRLQ
AKVIYCNYMDPDNLTFTDIRILGMDKQPANFTVIVNGSVTSDVLNVTYSASTKVVTITNL
QGLALGQEFSLEWSLPVSDLEKFNCYPEGPTASEESCRQRGCLWEPTTAPGVPACYYDTI
PNYAASNIQYLSTGITTHLALLTPPESERAAAAPPPPPPSGRELPLPGRPATTASDPLSA
KIGSLEVSVIYHTESMLQVKIYDPTNKRYEVPVPLNIPPSPVDSPENCLYDVRILNNPFG
IQVRRKNPNTVIWDSQLPGFIFSDMFLSISTHLPSQYIYGFGESEHTAFRRNMSWNTWGM
FARDEPPAYKKNSYGVHPYYMALEDDGSAHGVLLLNSNAMDVTFQPTPALTYRITGGILD
FYMVLGPTPELVTQQYTELIGRPVMPPYWALGFQLSRYGYQDATEISDLYDEMVAAQIPY
DVQHVDIDYMDRKLDFTLSPSFQNLSRLIEQMKKNGMRFILVLNPAISGNETEYLTFNRG
RDNNVFIKWPDTNDIVWGKAWPDLPNVIVNGSLDHETQVKLFRAHVAFPDFLRNSTAAWW
KKEIEMLYGNSQEPEKNLKFDGLRIDMNEPSNFVDGSVRNCNNEILNNPPYMPYLESRDK
GLSSKTLCMESQQILPDGSLVRHYDVHSLYGWSQTRPTYEAVQEVTGQRGIVITRSTFPS
SGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFGDAEYEMCIRWMQLG
AFYPFSRNHNTVGTRRQDPVAWNSAFEMFSRKVLQTRYTLLPYLYTLMHKAHVEGSTVVR
PLLHEFTGDKTTWNIDRQFMLGPAILISPVLESNILEISAYFPRARWYDYSTASGSDSTG
EWKFLEAPLDHINLHVRGGFILPWQEPASNTHYSRQNFMGLTVALDDNGRAEGQMFWDDG
QSIDTYENGNYFLAEFTADQNILRIQTIHNKYLNDANPLRVGYIRIWGMNSSYVTQVSFI
YDNQLSMETNFKSDPYNQTLIIQLTNKNISLEKLTEVTWIHGAITTTASTTTTDFATTTP
SLTSSADTTIGTIIPDTTTTSPRTDTTTGTSATTPIITTSSPMTTTNANGSTSVPNTTVY
STISTTVDTTSVTTPTITTSFPTSTADVNVSTAVPNTTAYSTISTTVDTTSVTTPTITTS
FPTSTADVNVSTAVPNTTAYSTISTTVDTTSVTTPTITTSFPTSTADVNVSTAVPNTTAY
STISTTVDTTSVTTPTITTSFPTSTADVNVSTAVPNTTAYSTISTTVDTTSVTTPTITTS
FPTSTADVNVSTAVPNTTAYSTISTTVDTTSVTTPTITTSFPTSTADVNVSTAVPNTTAY
STISTTVDTTSVTTPTITTSFPTSTADVNVSTAVPNTTAYSTISTTVDTTSVTTPTITTS
FPTSTADVNVSTAVPNTTAYSTISTTVDTTSVTTPTITTSFPTSTADVNVSTAVPNTTAY
STISTTVDTTSVTTPTITTSFPTSTADVNVSTAVPNTTAYSTISTTVDTTSVTTPTITTS
FPTSTADVNVSTAVPNTTAYSTISTTVDTTSVTTPTITTSFPTSTADVNVSTAVPNTTAY
STISTTVDTTSVTTPTITTSFPTSTADVNVSTAVPNTTAYSTISTTVDTTSVTTPTITTS
FPTSTADVNVSTAVPNTTAYSTISTTVDTTSVTTPTITTSFPTSTADVNVSTAVPNTTAY
STISTTVDTTSVTTPTITTSFPTSTADVNVSTAVPNTTAYSTISTTVDTTSVTTPTITTS
FPTSTADVNVSTAVPNTTAYSTISTTVDTTSVTTPTITTSFPTSTADVNVSTAVPNTTAY
STTVYSTISTTIDTTSAAAPIITTSFPTSTADINVSTAVPNTTAYSTISITTDSTSATDY
VTTTSSPSSADVTTSNIILNTTMTSTTTTTASTSATAPVLTMSSPTSTADASTSTALPNT
TSSFATSSTPSILTTPFPTSTADTNISTALPNTTSSFPTSGTPPILTTPFPTSTADTSTS
TALPNTTSSFPTSGTPPILMTPFPTSTADTNFSTAYPNTAFSFPTSGTPPILTTSFLKST
ADVNISTALPNTTVSSPISPSTANIVPPGSITTIPFRTATSNTSSVIVPNTTAPSTTSTT
ISTSITDFITSTSLSTSTIDATTSTIVPNTNTPSPTNVTTDSTSATDPIRATPFPISSLD
ISTTPSDPIIPSPTSTTATDTSATVPITTTPSPISSTDVTTSFTTLGSTSHSPRSVTTTP
ARNNTTLTPTNLSNAGTSSTTIKNTTATGVDSLTRNIINITTVGDIDTTARATVVTKITN
VTSVETTTQVISTPPPVDTSGANTTALTGNITIT
NT seq 9465 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgtctgccgcccatcccagaatagctatggcgaggaaactcactgtattggaa
gtccttctgatcatctatttcctcattgtgtcggtcatagatatcctcttgctgtttttt
gtattggaaaaaactcctccagattcttcatttattccagagtgcccagatatctccaac
tccgaaaggatagactgtgcacctggccaggtggtgacagaggagatctgcaggaggtac
tacaagtgctgctggaagcctctggaagactccaacgtccctaagtgcttcttccccagg
aattggggatatgaagtcagtgatgccagaacaattacaagcaggggattttctgtcaag
ttgaaaaggtttccatccccatctctgtttggatatgatgtcaacaacaccctcttcaca
gctgaatatcagacatccaatcgctttcgttttaagatcactgatgacaataacaaacgc
tatgaagttccccttacaattaagtcgggtaacgagactgcggatacctccaatttgaac
tatgacatagaggtcattgataaacccttcagcctcaaaataatgaggagaagcaacaga
agagtcttgttggacacgggcattggacctcttctgtatgctcagcagtacttgcaactg
tctttccgactgcccagcaccaatgtgtatgggctgggggaacacgtgcaccagcagtac
ctccacaacatgacctggaagacctggcccatcttcacccgtgatgccacccccacagag
gatatgattaatctgtatggagctcatacattcttcttgtgccttgaagacaccagtggc
ttttcttttggagtttttctaatgaacagtaatgccatggaggtcaccctccagcctgct
cctgcgatcacttaccgcacgattggaggcattcttgacttctatgtatttctcgggaac
actccagaacaagtggttcaggaatacctggagcttattggacgaccatttttgccttcc
tactggagtcttgggttccagcttagtcgcagggattatggtggcatcgatggattgaaa
gaagttgtgagcagaactcgtaaagctggaatcccatatgatgtccagtattctgacata
gactatatggatggaaagaaggattttactttaaacaacgcttaccttgatctcccagct
tttgccgaagaattacatgacaaaggacagaagtatgtcattatcttgcatcctggcatc
tctaatacttctgggtaccaaccctatcagaatggcaacacaaagagagtatggatcttg
gatggcaatggctttgctgttggagagggatatcctggaccaacagttttccctgattat
agcaatgatgaatgcattcagtggtggaaggaggagctcactaaatttcatacagagtta
gcatttgatggagtgtggattgaaatggatgaactatctagctttcgtcaacgtcctggt
cctgagtgtgaatcaaacagcttgaactttcctcccttcactcctagagtcctggaccgc
ttacttttttcaagaaccctctgtatggacacagaatttcaaaagggctttcactacgac
atccacagtctttatggctacttcatggcaaacgccacaaactcggccttggagtctctc
ttccccaataacaggagcttcatcttatcccgctctacttttgcgggatccggcacggtt
gctgcccattggttgggggacaatgcggccacctggaatgacctccgatggtccatcccc
agtatccttgagttcaacctgtttggcatccccatggttggtgccaacatctgtggttat
tcaaaagatgtcacagaggagctttgcagacggtggatgcagcttggagcattttatcca
ctatccaggaatcacaatgggcctgggttcagggaccaggacccagctgccttcggagag
gactccctgctgctgaattcctccaggcactaccttaacatccgctataccctgctgccc
tacctgtacacgcttttctaccgcgcccacaccctgggggacactgtggccaggcctctt
gtacacgagttctaccaggaccccgccacatgggccatccacgagcagttcttatggggg
cctggactcctcatcacgcctgttttatatgaaggtgtggaccacgtgaaagcgtatgta
ccggatgccatctggtatgactatgagacaggagtggccatggaacagaggaaacaatgg
gtggatatgctgctcccaggtgataagatgggacttcaccttcgagggggctacatattt
cccacccagcaaccaggcacaagcacagaggtcagtcggaagaactccctgggactcatt
gttgctttggactataagagagaagggaaggggcagctgtactgggatgacggtgtatcg
agagctgctgtaacaaattatattttgtataatttctctgttacttctaaccgtctacag
gcaaaggttatatattgtaattacatggaccctgacaacctgacgtttacagatatcaga
atcctgggaatggacaagcagccggctaattttactgtcatagttaatggtagtgttacc
tccgacgtgctgaatgtcacctacagtgcttcaacaaaggtggtgaccattactaacctc
cagggattggccctgggacaagaattctcccttgagtggagtcttccagtcagtgactta
gagaagttcaactgctaccctgagggtcctacggcctctgaggagagttgcaggcagcgt
gggtgcctttgggagcccacgactgctccaggcgtgcccgcctgctactatgacaccatt
cctaattacgctgccagtaacattcagtacctgtccacgggcatcaccacacaccttgcc
ctcctgacgccccctgagtctgagcgggcagcggcggcaccaccacctccaccaccatca
ggtcgtgagctgcctctgcctggccgacctgcaaccaccgcctctgatcctctctctgca
aagattggctccctggaagtgagcgtcatctaccacacagaatccatgctgcaggtcaag
atctatgatcccactaataaaaggtatgaggtcccagtgcctctgaatatacctccctca
ccagttgactcccctgaaaactgcctgtacgatgtcaggattctgaacaatccttttgga
atccaggttcgacgcaaaaaccccaacactgtgatttgggactctcagctccccggcttc
atcttcagcgacatgttcctctccatttctacccaccttccctcgcagtacatctatggc
tttggggaaagtgagcacacagctttcagaagaaacatgagctggaacacatggggaatg
tttgctcgtgatgagcccccagcgtacaagaagaactcctatggtgtccacccctactat
atggcactggaggacgatggtagtgcccacggagtgctcctgctcaacagcaatgccatg
gatgtgacattccagcctacacctgctctgacatatcgcatcacaggagggattttggac
ttttatatggttttagggccaacccctgaacttgtaactcagcaatacactgagttgatt
ggtcgtccagtgatgcctccatactgggccttgggattccagttgagtcgctatggatac
caggatgctactgaaatctccgatttgtacgatgagatggtggcagcacagattccctat
gatgtccagcatgtagacatcgactacatggaccggaagctggacttcaccctcagcccc
agctttcaaaacctcagccgcctgattgagcagatgaagaaaaatggcatgaggtttatt
ctcgttctgaatccagctatttctggtaatgagacagaatatctcacattcaacagagga
cgggataacaacgtgttcatcaagtggcctgacaccaatgacatcgtctggggaaaggct
tggccagatctgcccaatgtaattgtgaatggatcccttgatcatgaaacacaggttaag
ctgttcagggcccacgttgcttttcctgacttcttgcggaacagcacagcagcatggtgg
aagaaggagatagaaatgctctacggaaactctcaagaaccagagaagaacttgaagttt
gatggattacggattgatatgaatgagccatcgaacttcgtggatgggtcggtcaggaac
tgcaataatgaaattcttaataacccaccctacatgccatatttggaatccagggacaag
ggcctgagcagcaagaccctgtgcatggagagccagcagatcctgcctgatgggtccctg
gtgcggcactacgacgtgcacagcctttacggatggtcccagaccagacccacatacgaa
gccgtgcaggaggtgacgggacagcgaggcattgtcatcacccgctccaccttcccctct
tctggccgctgggcaggacactggctgggagacaacacagctgcatgggaccagctgaag
aaatcaatcattggcatgatggagttcagtctctttggaatatcttatacaggagcagat
atttgtggattctttggagatgccgaatatgagatgtgtattcgctggatgcaactgggt
gcattttacccattttccaggaatcacaacaccgttgggacaaggagacaagatcctgtg
gcctggaattcggcctttgagatgttttcaaggaaagtcctccagaccaggtacaccctg
ctgccttacctctacactctgatgcataaagcccatgtcgagggcagcactgtcgtccgg
ccccttctccatgaattcacaggtgataaaacaacatggaatatagaccgtcagttcatg
ttgggccctgccattttaatcagccctgttctggaaagtaacattttggagatcagtgct
tattttcccagagcccgttggtatgactatagtacggcatctggcagtgattcaacaggt
gagtggaaattcctggaagctccccttgaccacatcaaccttcatgtccgaggagggttc
atcttgccatggcaggaacctgcaagtaacactcactacagtcgacaaaactttatggga
ttgactgttgctttggatgataatggaagagctgagggtcagatgttctgggatgatgga
caaagcattgatacttatgaaaatggaaactatttcttggcagaatttacggcagatcag
aacatcttgcgaatacagaccatacacaataagtatttgaatgatgcaaatccactgaga
gttggatatattagaatctggggtatgaactcttcttatgtgacacaagtcagtttcatc
tatgacaaccagttatccatggagacaaatttcaagagtgacccttacaatcagacacta
attattcaactgactaacaagaatatcagtctggaaaagttaaccgaagttacttggatt
catggtgctattacaactactgcaagcactactactactgattttgccacaaccactcct
tccctgacaagttctgctgatactacgataggtactattattcctgatacaactactact
tcccctcgaactgatacaactactggcactagtgctactactcctattataactacatca
tcccctatgactactaccaatgctaatggtagtacttctgtccctaatacgactgtgtat
tctaccatcagtactactgtagataccaccagtgttaccactcctaccataaccacatca
ttccctacaagtactgctgatgttaatgtcagtactgctgtccctaatacgactgcgtat
tctaccatcagtactactgtagataccaccagtgttaccactcctaccataaccacatca
ttccctacaagtactgctgatgttaatgtcagtactgctgtccctaatacgactgcgtat
tctaccatcagtactactgtagataccaccagtgttaccactcctaccataaccacatca
ttccctacaagtactgctgatgttaatgtcagtactgctgtccctaatacgactgcgtat
tctaccatcagtactactgtagataccaccagtgttaccactcctaccataaccacatca
ttccctacaagtactgctgatgttaatgtcagtactgctgtccctaatacgactgcgtat
tctaccatcagtactactgtagataccaccagtgttaccactcctaccataaccacatca
ttccctacaagtactgctgatgttaatgtcagtactgctgtccctaatacgactgcgtat
tctaccatcagtactactgtagataccaccagtgttaccactcctaccataaccacatca
ttccctacaagtactgctgatgttaatgtcagtactgctgtccctaatacgactgcgtat
tctaccatcagtactactgtagataccaccagtgttaccactcctaccataaccacatca
ttccctacaagtactgctgatgttaatgtcagtactgctgtccctaatacgactgcgtat
tctaccatcagtactactgtagataccaccagtgttaccactcctaccataaccacatca
ttccctacaagtactgctgatgttaatgtcagtactgctgtccctaatacgactgcgtat
tctaccatcagtactactgtagataccaccagtgttaccactcctaccataaccacatca
ttccctacaagtactgctgatgttaatgtcagtactgctgtccctaatacgactgcgtat
tctaccatcagtactactgtagataccaccagtgttaccactcctaccataaccacatca
ttccctacaagtactgctgatgttaatgtcagtactgctgtccctaatacgactgcgtat
tctaccatcagtactactgtagataccaccagtgttaccactcctaccataaccacatca
ttccctacaagtactgctgatgttaatgtcagtactgctgtccctaatacgactgcgtat
tctaccatcagtactactgtagataccaccagtgttaccactcctaccataaccacatca
ttccctacaagtactgctgatgttaatgtcagtactgctgtccctaatacgactgcgtat
tctaccatcagtactactgtagataccaccagtgttaccactcctaccataaccacatca
ttccctacaagtactgctgatgttaatgtcagtactgctgtccctaatacgactgcgtat
tctaccatcagtactactgtagataccaccagtgttaccactcctaccataaccacatca
ttccctacaagtactgctgatgttaatgtcagtactgctgtccctaatacgactgcgtat
tctaccatcagtactactgtagataccaccagtgttaccactcctaccataaccacatca
ttccctacaagtactgctgatgttaatgtcagtactgctgtccctaatacgactgcgtat
tctaccatcagtactactgtagataccaccagtgttaccactcctaccataaccacatca
ttccctacaagtactgctgatgttaatgtcagtactgctgtccctaatacgactgcgtat
tctaccatcagtactactgtagataccaccagtgttaccactcctaccataaccacatca
ttccctacaagtactgctgatgttaatgtcagtactgctgtccctaatacgactgcgtat
tctaccatcagtactactgtagataccaccagtgttaccactcctaccataaccacatca
ttccctacaagtactgctgatgttaatgtcagtactgctgtccctaatacgactgcgtat
tctacgactgtgtactctaccatcagtactactatagataccaccagtgctgctgctcct
atcataaccacatcattccctacaagcactgctgatattaacgttagtactgctgtccct
aatacaactgcgtattctaccatcagtattactactgatagtactagtgctactgattat
gtcacaaccacttcttccccaagttctgctgatgttacaactagtaatattattctgaat
acaactatgacttctacaactactacaactgctagcaccagtgctactgctccagtctta
actatgtcatcccctacaagtactgctgatgctagcactagcactgctctccctaataca
acttcttcctttgctactagtagtactccttctatcctaacgacaccattccctacaagt
actgcagatactaacattagcactgctcttcctaatacaacttcttccttccctactagt
ggtactcctcctatcctaactacaccattccctacaagtactgcagatactagcactagc
actgctctccctaatacaacttcttccttccctactagtggtactcctcctatcctaatg
acaccattccctacaagtactgcagatactaactttagtactgcttaccctaatacagct
ttttcttttcctactagtggtactcctcctatcctaactacatcattccttaaaagtact
gctgatgtgaacattagtactgctctccctaatacaactgtctcttctcctattagtcct
agtactgctaatattgttcctcctgggtctatcacaaccattcctttccgaacagctact
agtaatactagtagtgttattgttcctaatacaactgctccttccactaccagtactact
atcagtactagtattactgattttatcacaagcacttctttatctactagtactattgat
gctacaactagtactattgttcctaatacaaatacaccttcccctacaaatgttactact
gatagcactagtgcaactgatcctatcagagccactcctttcccaataagttctttagat
attagtactaccccttctgatccaattattccttctcctacaagcactactgctactgac
actagtgctactgttcctatcacaaccactccttctccaataagttctactgatgttaca
actagttttactactcttggtagcactagtcactcccccagaagtgttactacaacacca
gccagaaacaacacaaccctgactcctacaaatttatctaatgctggcactagcagtact
actatcaaaaacaccacagctactggtgtggattcacttactagaaatattataaatatt
accactgtaggagacatagatacaactgcaagagccactgtggtcactaagattacaaac
gttacttctgtagaaactaccactcaggtgatttccactccacctcctgtagacacctct
ggtgccaacaccactgcacttactggaaatattaccatcacttag

DBGET integrated database retrieval system