KEGG   Tupaia chinensis (Chinese tree shrew): 102480366
Entry
102480366         CDS       T02978                                 

Gene name
TRPC1
Definition
(RefSeq) transient receptor potential cation channel subfamily C member 1
  KO
K04964  transient receptor potential cation channel subfamily C member 1
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04360  Axon guidance
tup04724  Glutamatergic synapse
tup04726  Serotonergic synapse
tup04929  GnRH secretion
tup04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:tup00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    102480366 (TRPC1)
  09154 Digestive system
   04972 Pancreatic secretion
    102480366 (TRPC1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102480366 (TRPC1)
   04726 Serotonergic synapse
    102480366 (TRPC1)
  09158 Development and regeneration
   04360 Axon guidance
    102480366 (TRPC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tup04040]
    102480366 (TRPC1)
Ion channels [BR:tup04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   102480366 (TRPC1)
SSDB
Motif
Pfam: TRP_2 Ion_trans Ank_2 Ank_4 DUF2157
Other DBs
NCBI-GeneID: 102480366
NCBI-ProteinID: XP_006162361
LinkDB
Position
Un
AA seq 795 aa
MMAALYPSTDLSGASSSSLPSSPSSSSSPNEVMALKDVREVKEENTLNEKLFLLACDKGD
YYMVKKILEENSSGDLNINCVDVLGRNAVTITIENENLDILQLLLDYGCQSADALLVAID
SEVVGAVDILLNHRPKRSSRPTIVKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLL
KQDVSLPKPHAVGCECTLCSAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFE
LSADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSRELEVILNHTSSDEPLDKRG
LLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRRKPTCKKIMTVLTVGI
FWPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGXXXXXXXXXXXNLYSLVYNEDKKNTMGP
ALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHN
KFHDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFG
KFLGMFLLVLFSFTIGLTQLYDKGYTPKEQKDCVGIFCEQQSNDTFHSFIGTCFALFWYI
FSLAHVAIFVTRFSYGEELQSFVGAVIVGTYNVVVVIVLTKLLVAMLHKSFQLIANHEDK
EWKFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSKWICSHTSKGKVKRQNSLK
EWRNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEIRDL
LGFRTSKYAMFYPRN
NT seq 2388 nt   +upstreamnt  +downstreamnt
atgatggcggccctgtacccgagcacggacctctcgggcgcctcctcctcctccctgcct
tcctccccatcctcctcttcgtcgcccaacgaggtgatggcgctgaaggatgtgcgggag
gtgaaggaggagaacaccctgaacgagaagcttttcttgctggcgtgcgacaagggtgac
tattatatggttaaaaagatattggaggaaaacagttcaggtgacttgaacataaattgc
gtagatgtgcttgggagaaatgctgttaccataactattgaaaacgaaaacttggatata
ctgcagcttcttttggactacggttgtcagtccgcagatgcacttttggtggcaatcgac
tctgaagtagtgggagccgttgatatactacttaatcatcgaccaaaacgatcatcaaga
ccaactatagtaaaacttatggaacgaattcagaatcctgagtattcaacaactatggat
gttgcacctgtcattttagctgctcatcgtaacaactatgaaattcttacaatgctttta
aaacaggatgtatctctacccaagccccatgcagttggctgtgaatgcacattgtgttct
gcaaaaaacaaaaaggacagcctccgacattccaggtttcgtcttgatatttatcggtgt
ttggccagtccggctctaataatgttaacagaggaagatccaattctgagagcatttgaa
cttagtgctgacttaaaagaactaagccttgtggaagtggaattcaggaatgattatgag
gaactagcccggcaatgtaaaatgtttgccaaagatttgcttgctcaagcccggaattca
cgtgaattggaagttatcttaaaccatacgtctagtgatgagcctcttgacaaacgggga
ttactagaagaaagaatgaatttaagtcgtctaaaacttgctatcaaatataaccaaaag
gagtttgtctcccaatctaactgccaacaattcctgaacactgtttggtttggacagatg
tcaggttaccgacgtaagcccacctgtaagaagataatgactgttttgacagttggcatc
ttttggccagttttgtcactttgttatttgatagctcccaaatctcaatttggcagaatc
attcacacaccttttatgaaatttattattcatggnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnntaaatctgtactctcttgtctacaatgaggataagaaaaacacaatgggacca
gcccttgaaagaatagactatctccttatactgtggattattgggatgatctggtcagac
attaaaagactctggtacgaagggttagaagacttcttagaagaatctcgtaatcaactc
agttttgtcatgaattctctctatttggcaacctttgctctcaaagtggttgctcacaac
aagtttcatgattttgctgatcggaaggactgggatgcattccatcctacactggtcgca
gaagggctttttgcatttgcaaatgttctgagttatcttcggctattttttatgtataca
accagctctatcttgggtccattacagatttcaatgggacagatgttacaagattttgga
aaatttcttgggatgtttcttcttgttttgttttctttcacaattggactaacacaactg
tatgataaaggctatactccaaaagagcagaaggactgtgtcggcatcttctgtgaacag
caaagcaatgataccttccactcgttcattggcacttgctttgctttgttctggtacatt
ttctccttggcacatgtggcaatctttgtcacgagatttagctatggagaggaattgcag
tccttcgttggagccgttattgttggtacttacaatgtcgtggtagtgatcgtgcttacc
aagctgctggtggcaatgcttcataaaagctttcagttgatagcaaatcatgaagacaaa
gaatggaagttcgctagagcgaagttgtggcttagctactttgatgacaaatgtacacta
cccccacctttcaacatcattccttcaccaaagactatctgctatatgattagtagcctc
agtaagtggatttgctctcatacatcaaaagggaaagtcaaacggcaaaacagtttaaag
gaatggagaaatttgaaacaaaagagagatgaaaactaccaaaaagtgatgtgctgctta
gtgcatcgttacctgacttccatgagacagaagatgcaaagtacagatcaggccactgtg
gagaacctcaatgaactgcgccaggatctgtcaaaattccgaaatgaaataagggattta
cttggttttcggacttccaaatatgctatgttttatccaagaaattaa

DBGET integrated database retrieval system