KEGG   Tupaia chinensis (Chinese tree shrew): 102480936Help
Entry
102480936         CDS       T02978                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00020  Citrate cycle (TCA cycle)
tup00190  Oxidative phosphorylation
tup01100  Metabolic pathways
tup01200  Carbon metabolism
tup04714  Thermogenesis
tup04932  Non-alcoholic fatty liver disease (NAFLD)
tup05010  Alzheimer disease
tup05012  Parkinson disease
tup05016  Huntington disease
Module
tup_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tup_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tup_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102480936 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102480936 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    102480936 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    102480936 (SDHB)
   05012 Parkinson disease
    102480936 (SDHB)
   05016 Huntington disease
    102480936 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102480936 (SDHB)
Enzymes [BR:tup01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102480936 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7 Fer4_9
Motif
Other DBs
NCBI-GeneID: 102480936
NCBI-ProteinID: XP_006145292
UniProt: L9L0M2
LinkDB All DBs
Position
Un
AA seq 280 aa AA seqDB search
MAAVVAVSLRRRVPAAALGGTCLQACRGAQTAAATAPRIKKFAIYRWDPDKAGDKPRMQT
YEIDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQGGKQQYLQSIEEREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKERKASA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtcgcagtctccttgaggcgccgggtcccggccgcagctcttggcgga
acctgcctgcaggcctgccgaggcgcccagacagctgcagccacagctccccgaatcaag
aaatttgccatctaccggtgggacccagacaaggctggagataaacctcgtatgcagacc
tatgaaattgatctgaataagtgtggtccaatggtattggatgccttgatcaagattaag
aatgagattgactctaccttgaccttccgaagatcatgcagagaaggcatctgcggctct
tgtgccatgaacatcaacggaggcaacactctcgcttgcacccgcaggatcgacaccaac
ctcaataaagtctcaaaaatctaccctctcccacatatgtacgtgataaaggatcttgtt
cctgatttgagcaacttctatgcgcagtacaaatccattgagccttacttgaagaagaag
gacgagtcccagggaggcaagcagcagtatctgcagtccatagaagagcgtgagaaactg
gacgggctctacgagtgcatcctctgtgcctgctgtagcaccagctgccccagctattgg
tggaacggagacaaatacttggggcctgctgttcttatgcaggcctaccgctggatgatt
gactccagagacgacttcacagaggagcgcctggccaagctgcaggacccgttctctctg
taccgctgccacaccatcatgaactgcacaaggacctgtcccaagggtctgaatccaggg
aaagctattgctgaaatcaagaaaatgatggcgacctataaggagaggaaggcttcggct
taa

DBGET integrated database retrieval system