KEGG   Tupaia chinensis (Chinese tree shrew): 102481620Help
Entry
102481620         CDS       T02978                                 

Gene name
RASSF5
Definition
(RefSeq) Ras association domain family member 5
  KO
K08015  Ras association domain-containing protein 5
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04014  Ras signaling pathway
tup04015  Rap1 signaling pathway
tup04218  Cellular senescence
tup04670  Leukocyte transendothelial migration
tup05200  Pathways in cancer
tup05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102481620 (RASSF5)
   04015 Rap1 signaling pathway
    102481620 (RASSF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102481620 (RASSF5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    102481620 (RASSF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102481620 (RASSF5)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    102481620 (RASSF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2
Motif
Other DBs
NCBI-GeneID: 102481620
NCBI-ProteinID: XP_014447391
LinkDB All DBs
Position
Un
AA seq 419 aa AA seqDB search
MAMASPAIGQRPYPLLLDPEPPCYLQTLSGPEPQPPPPPPGRSSRRCAPAPLSTAPGAHE
GRGARRAPRGDADPQPRASRPARPLRPGLQQRLRRRPGAPRPRDVRSIFEQPQDPRVPAE
RGEGHCFVELALRGGPGWCDLCGREVLRQALRCANCKFTCHPQCRSLIQLDCSRQGGSAQ
DRPSPESTLAPTFGQNVCKPVEPQRPPTLQEIKQKIDSYNTREKNCLGMRLSEDGTYTGF
IKVHLKLRRPVTVPAGIRPQSIYDAIKDVNLAATTDKRTSFYLPLDAIKQLHISSTTTVS
EVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSVADCPLSLRLLAGPDTDVLSFVL
KENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGQPG
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggccatggcgtccccggccatagggcagcgtccgtacccgctactcttggaccccgaa
ccgccgtgctatctgcagaccctgagcggccccgagccgcagcctccgccgccgccgcct
ggtcggtcctcccgccgctgcgcccccgcgcctctctccactgcacccggggcgcacgag
gggcgcggtgcccggagggctcctcggggggacgcggatccccagccgcgggcctcccga
cctgctcgccctctccggcctggtctgcagcagagactgcggcggcgacccggagctcct
cggccccgcgacgtgcggagcatcttcgagcagccgcaggatccccgcgtcccggcggag
cgaggcgagggacactgcttcgtcgaactggcactgcggggtggcccgggctggtgtgac
ctgtgtggacgagaggtgctgcggcaggcgctgcgctgcgctaactgtaaattcacctgc
caccctcagtgccgcagcctgatccagctggactgcagtcggcaggggggctcagcccag
gacaggccttctccagagagtaccctcgccccgaccttcggccagaatgtctgtaaaccg
gtggagccacagcgcccgcccacgctacaggagatcaagcagaagattgacagctacaac
acccgggagaaaaactgcctgggcatgaggctgagcgaggacggcacctacacgggtttc
atcaaagtgcatttgaaactgcggcggcccgtgacggtgcccgctgggatccggccccag
tccatctatgacgccatcaaggacgtgaacctggcagccaccacggacaagcggacgtcc
ttctacctgcccctcgacgccatcaagcagctgcacatcagtagcaccaccacggtcagt
gaggtcatccaggggctgctgaagaagttcatggtcgtggacaacccccagaagtttgca
ctttttaagcggatacacaaggatggacaagtgctcttccagaagctctccgtggctgac
tgccccctctccctgcgcctgctcgctgggcctgacactgacgtcctcagctttgtgcta
aaggagaacgagactggagaggtggagtgggatgccttctccatccctgaactccagaac
ttcctaacaatcctggaaaaggaggagcaggacaaaatccagcaggtgcagaagaagtat
gacaagtttaggcagaaactggaagaggccttaagggaatcccagggccaacctgggtaa

DBGET integrated database retrieval system