KEGG   Tupaia chinensis (Chinese tree shrew): 102482534
Entry
102482534         CDS       T02978                                 

Gene name
RASSF1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04014  Ras signaling pathway
tup04390  Hippo signaling pathway
tup04392  Hippo signaling pathway - multiple species
tup05200  Pathways in cancer
tup05206  MicroRNAs in cancer
tup05219  Bladder cancer
tup05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102482534 (RASSF1)
   04390 Hippo signaling pathway
    102482534 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    102482534 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102482534 (RASSF1)
   05206 MicroRNAs in cancer
    102482534 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    102482534 (RASSF1)
   05223 Non-small cell lung cancer
    102482534 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH Mst1_SARAH DUF5111
Other DBs
NCBI-GeneID: 102482534
NCBI-ProteinID: XP_006169438
LinkDB
Position
Un
AA seq 270 aa
MGEAETPSFEMTWSSTTSSGYCSQEDSDSELEQYFTARTSLVRRPRRDQDEPVERETPDL
SQAEIEQKIKDYNGQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPASKKPPTLQDARR
GPGRGPAVKRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERAER
HGQVYLRKLSDDEQPLRLRLLAGPSEKALSFVLKENDSGEVNWDAFSMPELHNFLRILQR
EEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 813 nt   +upstreamnt  +downstreamnt
atgggcgaggcggagacgccttctttcgagatgacctggagcagcacgacgagcagtggc
tactgcagccaggaggactcggactcggagctcgagcagtacttcactgcgcgcacctcg
ctggtgcgcaggccgcgccgggatcaggatgagcctgtggaacgggagacacctgacctt
tctcaggctgaaattgagcagaagatcaaagactacaatggccagatcaacagcaacctc
ttcatgagcctgaacaaggatggctcctacacaggcttcatcaaggtccagctgaagctg
gtgcgtcctgtctcagtgccagccagcaagaagccccccaccttgcaagatgcccggcgg
ggcccagggcggggcccagccgtgaagcgccgcacctccttttacttgcccaaggatgct
gtcaagcacctgcatgtactgtcgcggacccgggcacgtgaggtcatcgaggccctgctg
cgcaagttcttggtggtagacgacccccgcaagtttgcactttttgagcgggctgagcgt
catggccaagtgtacctgcggaagctgtcggatgatgagcagcccctgcgactgcggctc
cttgcagggcccagtgagaaggccctgagcttcgtcctgaaggagaatgactctggggag
gtgaattgggacgctttcagcatgcctgaactgcacaacttcctgcgcatcctgcagcgc
gaagaggaagagcacctccgccagatcctccagaagtactcctattgccgccagaagatc
caagaagccctgcatgcctgcccactggggtga

DBGET integrated database retrieval system