KEGG   Tupaia chinensis (Chinese tree shrew): 102483778
Entry
102483778         CDS       T02978                                 

Gene name
IL4
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04060  Cytokine-cytokine receptor interaction
tup04151  PI3K-Akt signaling pathway
tup04630  JAK-STAT signaling pathway
tup04640  Hematopoietic cell lineage
tup04657  IL-17 signaling pathway
tup04658  Th1 and Th2 cell differentiation
tup04659  Th17 cell differentiation
tup04660  T cell receptor signaling pathway
tup04664  Fc epsilon RI signaling pathway
tup04672  Intestinal immune network for IgA production
tup05140  Leishmaniasis
tup05200  Pathways in cancer
tup05310  Asthma
tup05320  Autoimmune thyroid disease
tup05321  Inflammatory bowel disease
tup05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102483778 (IL4)
   04151 PI3K-Akt signaling pathway
    102483778 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102483778 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102483778 (IL4)
   04660 T cell receptor signaling pathway
    102483778 (IL4)
   04658 Th1 and Th2 cell differentiation
    102483778 (IL4)
   04659 Th17 cell differentiation
    102483778 (IL4)
   04657 IL-17 signaling pathway
    102483778 (IL4)
   04664 Fc epsilon RI signaling pathway
    102483778 (IL4)
   04672 Intestinal immune network for IgA production
    102483778 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102483778 (IL4)
  09163 Immune disease
   05310 Asthma
    102483778 (IL4)
   05320 Autoimmune thyroid disease
    102483778 (IL4)
   05321 Inflammatory bowel disease
    102483778 (IL4)
   05330 Allograft rejection
    102483778 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102483778 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tup04052]
    102483778 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:tup00536]
    102483778 (IL4)
Cytokines and growth factors [BR:tup04052]
 Cytokines
  Interleukins
   102483778 (IL4)
Glycosaminoglycan binding proteins [BR:tup00536]
 Heparan sulfate / Haparin
  Cytokines
   102483778 (IL4)
SSDB
Motif
Pfam: IL4 Dymeclin
Other DBs
NCBI-GeneID: 102483778
NCBI-ProteinID: XP_006166982
LinkDB
Position
Un
AA seq 122 aa
MGLVSRLMPALLCLLACASHSVHRRRCDKALVEIIKTLNILTASKTLCTEVTVADIFAAS
KNTTEKETYCRAAAVLQPFYGHHGCLTEPKVARLLRGLNRNLHCLARSEDGQRLQTLEQG
RG
NT seq 369 nt   +upstreamnt  +downstreamnt
atgggtctcgtctcccgactgatgcccgccctgctctgcctgctggcgtgtgccagccac
tctgtccacagacgcagatgcgataaggccttagtagagatcatcaaaactctgaacatc
ctcacagcgagcaagactctgtgcaccgaggtgaccgtagcagacatctttgccgcatcc
aagaacacaaccgagaaggaaacctactgcagggctgcggctgtgcttcaaccgttctat
ggccaccatgggtgtctcacagaacccaaagtggcccgactcctgagaggactcaacagg
aacctccactgcctggcccgctcggaggacggccaacgcctgcagacgttggagcagggc
agaggctag

DBGET integrated database retrieval system