KEGG   Tupaia chinensis (Chinese tree shrew): 102483981
Entry
102483981         CDS       T02978                                 

Gene name
SHH
Definition
(RefSeq) sonic hedgehog
  KO
K11988  sonic hedgehog
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04340  Hedgehog signaling pathway
tup04360  Axon guidance
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05217  Basal cell carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102483981 (SHH)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    102483981 (SHH)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102483981 (SHH)
   05205 Proteoglycans in cancer
    102483981 (SHH)
  09162 Cancer: specific types
   05226 Gastric cancer
    102483981 (SHH)
   05217 Basal cell carcinoma
    102483981 (SHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tup01002]
    102483981 (SHH)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:tup00536]
    102483981 (SHH)
Peptidases and inhibitors [BR:tup01002]
 Cysteine peptidases
  Family C46: hedgehog family
   102483981 (SHH)
Glycosaminoglycan binding proteins [BR:tup00536]
 Heparan sulfate / Heparin
  Morphogens
   102483981 (SHH)
SSDB
Motif
Pfam: HH_signal Peptidase_M15_3 Hint
Other DBs
NCBI-GeneID: 102483981
NCBI-ProteinID: XP_006143886
LinkDB
Position
Un
AA seq 317 aa
MLPLARCLLVVLLSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASG
RYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGV
KLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAH
IHCSVRAGSRPGRAEPGAEPFIGIRTRRSACQAGSCDSRLGLADAPVGFRGLRRASNAPS
PHRLTVARGGALDFGLSLWVQREEALCHSRGWKEKGPGAAEAPGAGVHWYSQLLYRIGTW
LLDSEALHPLGMALTSS
NT seq 954 nt   +upstreamnt  +downstreamnt
atgctgccgctggcccgctgtctgctggtggtcctcctctcctcgctgctggtgtgctcg
gggctggcctgcgggccgggcaggggattcgggaagaggcggcaccccaagaagctgacc
cctttagcctacaagcagtttatccctaatgtagccgagaagaccctgggggccagcgga
agatatgaagggaagatctccagaaactcggagagatttaaggaactcacccccaattac
aaccccgacatcatatttaaggatgaagaaaacaccggagcagaccggctgatgactcag
aggtgtaaggacaagctgaacgccttggccatctccgtgatgaaccagtggccaggagtg
aagctgcgggtgaccgagggctgggacgaggatggccaccactcagaggagtcgctgcac
tacgagggccgcgccgtggacatcaccacgtccgaccgcgaccgcagcaagtacggcatg
ttggcgcgcctggcggtggaggccggcttcgactgggtgtactacgagtccaaggcccac
atccactgctcggtgagagcagggtcccgcccggggagagcagagcccggcgccgagccg
ttcatcggcattcggacccggcgcagtgcgtgtcaggcagggtcgtgcgactcgcgactc
gggctcgccgacgccccggtcggattccgggggctgcggagggcctccaacgcccccagc
cctcaccggctcaccgtggcccgcggcggggcgttggactttgggctcagcctctgggtc
cagcgcgaggaggcgctgtgccattcgcgggggtggaaggaaaaggggcccggcgcggcc
gaggcgcccggcgcgggcgtgcactggtactcgcagctgctctaccgaataggcacctgg
ctgttggacagcgaggccctgcaccccctgggcatggcgctcacgtccagctga

DBGET integrated database retrieval system