KEGG   Tupaia chinensis (Chinese tree shrew): 102484063
Entry
102484063         CDS       T02978                                 

Gene name
KIF7
Definition
(RefSeq) kinesin family member 7
  KO
K18806  kinesin family member 7
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04340  Hedgehog signaling pathway
tup05200  Pathways in cancer
tup05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102484063 (KIF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102484063 (KIF7)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    102484063 (KIF7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:tup04812]
    102484063 (KIF7)
Cytoskeleton proteins [BR:tup04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     102484063 (KIF7)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 102484063
NCBI-ProteinID: XP_006152922
LinkDB
Position
Un
AA seq 1258 aa
MGLEAQRLPAAEEAPVRVALRVRPLLPKELLYGHQSCLQVEPEHGRVTLGRDRHFGFHVV
LAEDTGQEAVYQTCVQPLLEAFFEGFNATVFAYGQTGSGKTYTIGEASVASLHEDEQGII
PRAMAEAFKLIDENDLLDCLVHVSYLEVYKEEFRDLLEVGTASRDIQLREDDRGNVVLCG
VKEVDVEGLDEVLSLLEVGNAARHTGATHFNRLSSRSHTVFTVTLEQRGRAPSRLPRPAG
GQLLVSKFHFVDLAGSERVLKTGSTGERLKESIQINGSLLALGNVISALGDPQRRGSHIP
YRDSKITRILKDSLGGNAKTVMIACVSPSASDFDETLNTLNYASRAQNIRNRATVNWRPE
ADALSSASGPDSGIESASAEDQAAQGSGGRKMTKGQEGEGAQQLLTLQSQVVRLEEENRD
FLAALEDAMEQYKLQSDRLREQQEEMVELRMRLELVRPGWGAPGLLQGLPPGSFVPRPHT
APLEGAHTQVLGMAPTACLPGDSVGSEQWGEQGTDSREAGTELLAKVDRPGSGSSAASDE
EDEEEVPRRTLHVRRNGISSWNQRVGAHPGSPPDRKGPELQLEDLGAAILGHRAAGGIKA
PVQTRQSLTATASEWRLAQAQQKIRELAINIRMKEELIGELVRTGKAAQALNRQHSQRIR
ELEQEAERVRAELSEGQRQLRELEDKEPQDAGERSRLQEFRKRVAAAQSQVQVLKEKKQA
TERLVSLSAQSEKRLQELERNVQLMRQQQGQLQRRLREETEQKRRLETEMNKRQHRVKEL
ELRHEQQQKILKIKTEEIAAFQRKRRSGSNGSVVSLEQQQKIEEQKKWLDQEMEKVLQQR
RALEELGEELRKREAILAKKEALMQEKSGLESKRLRSSQALSEDIVRVSSRLEHLEKELS
EKSGQLRQGSAQSQQQIRGEIDSLRQEKDSLLKQRLEIDSKLRQGSLLSPEEERTLFQLD
EAIEALDAAIEYKNEAITCRQRVLRASASLLSQCEMNLMAKLSYLSSSETRALLCKYFDK
VVTLREEQHQQQVAFSELEMQLEEQQRLGYWLEVALERQRLELDRQLTLQQKEHEQHIQL
LLQQSRDHLGEGLADSKRQYEARIQALEKELGRQMWLNQELRQKLCSVNASGHSRGGEKR
ALCLESRPAPGSEDEPHPVPELLWQHPLNEGAPCTREEVRDLVHAPLPLTWKRSNLCSSE
EQGSPDEQRQWEAAESLVGRVLPVAEVALPWNLGPLPKSRRELRRTSPGMIDVRKNPL
NT seq 3777 nt   +upstreamnt  +downstreamnt
atggggctggaggcccagaggctgccagcagcagaggaggccccagtgagggtggctctg
cgagtccgcccgctgctgcccaaggagctgttgtatgggcatcagagctgcctgcaggtg
gagccagagcatggtcgtgtcactctggggcgtgaccgccactttggcttccatgtagta
ctggctgaggacactgggcaggaggcggtgtaccagacctgtgtgcagcccctcctcgag
gccttctttgagggcttcaatgccaccgtctttgcctacggtcagacaggctccggaaag
acgtacaccataggagaggccagcgtggcctccctccatgaggatgagcagggcatcatt
ccaagggccatggccgaggccttcaagcttatcgatgagaacgacctgctggactgcctg
gtgcacgtgtcctacctggaagtgtataaggaggagttccgagacctgctcgaggtgggc
actgccagccgggacatccagctgcgggaagatgaccgcgggaacgttgtgctgtgcggg
gtgaaggaggtggacgtggagggcctggacgaggtgctgagcctgctggaggtgggcaac
gcagcgcggcacacgggggccacgcacttcaaccgcctgtccagccgctcacacacggtc
ttcaccgtgaccctggagcagcggggccgagcccccagccgcctgccgcgccctgccggc
ggccagctgctggtctctaagttccacttcgtggacctggcgggctcggagagagtgctc
aagaccggcagcaccggcgagcggctcaaggagagcatccagatcaatggtagcctgctg
gcactgggcaatgtcatcagcgccctgggggacccgcagcgacggggcagccacatcccc
taccgcgactccaagatcactcggatcctcaaagactcgctgggcggcaacgccaagacg
gtgatgatcgcctgcgtcagcccctcggcctccgacttcgacgagaccctcaacaccctc
aactacgccagtcgcgcacagaacatccgcaaccgcgccacagtcaactggcggcccgag
gccgacgcactgagctccgcctccgggcccgacagtggcattgagagtgcctccgctgag
gaccaggcggcgcaggggtccggcgggcgaaagatgaccaagggccaggaaggggagggg
gcgcagcaactgctgaccttgcagagccaggtggtgcggctggaggaggagaaccgagac
tttctggctgcattggaggacgccatggagcagtacaaactgcagagcgaccggctgcgt
gagcaacaggaggaaatggtggagctgcggatgcggctggagctggtgcggcctggctgg
ggggccccgggactcctgcagggcctacctccaggttcctttgtgcctcggcctcacaca
gccccccttgagggtgctcacactcaagtcctgggcatggcccccactgcctgcctccct
ggagattccgttggttctgagcagtggggagagcaggggacagacagcagggaggctggc
actgagctgctggccaaggtggacaggccaggaagtggctcttcagctgcatctgatgag
gaggacgaggaggaggtgcccaggcggaccttacacgtgcgcagaaatgggatcagcagc
tggaaccagagggtgggagcacacccaggaagtccaccggacaggaaaggcccagagctt
cagcttgaagacctgggtgcagccatcctgggacacagagcagccggtgggatcaaggcc
ccggttcagacccgccagagcctgactgccacagcctctgagtggcgactggcccaggcc
cagcagaagatccgggagctagccatcaacatccgcatgaaggaggagctcattggcgag
ctggtccgcacagggaaggcagcccaggccctgaaccgccagcacagccagcgcattcgg
gagctggagcaggaggctgagcgggtgcgggctgagctgagtgaaggccagaggcagctg
cgggagttggaggacaaggagccccaggatgctggtgagcgctctcggctgcaggagttc
cgcaagagggtggccgcggcccagagccaagtgcaggtgctgaaggagaagaagcaggcc
acggagcggctggtgtcactgtcagcccagagtgagaagcggctgcaggagctggagagg
aatgtgcagctcatgcggcagcagcaggggcagctgcagaggcggctccgtgaggagacg
gagcagaagcggcgcctggagactgagatgaacaagcgacagcaccgtgtcaaggagctg
gagctgaggcatgagcagcagcaaaagatcctgaagatcaagacagaagagattgcagct
ttccagaggaagagacgcagtggcagcaatggctctgtggtcagcctggagcagcagcag
aagattgaggagcagaagaagtggctggatcaggagatggagaaggtactgcagcagcgg
cgggcgctggaggagctgggggaggagctccgcaagagagaggccatcctggccaagaag
gaggccctgatgcaggagaagtcggggctggagagcaagcgcctgcggtccagccaggcc
ctcagcgaggacatcgtgcgagtgtccagccgcctggaacacctggagaaggagctctcc
gagaagagcgggcagctgcggcagggcagcgcccagagccagcagcagatccgcggggag
atcgacagcctgcgccaggagaaggactcgctgctgaagcagcgcctggagattgacagc
aagctgaggcagggcagcctgctgtcccctgaggaggagcggaccctgttccagctggat
gaggctatcgaggctctggacgctgccatcgagtataagaacgaggccatcacatgccgc
cagcgggtgctgcgggcttcggcctcgctgctgtcccagtgtgagatgaacctcatggcc
aagctcagctacctgtcatcctcagagacccgagccctactctgcaagtactttgacaag
gtggtgacactccgggaggagcagcaccagcagcaggtggccttctcggagctagagatg
cagctggaggagcagcagaggctggggtactggttggaggtggccctggagcggcagcgc
ctggagctggaccgccagctcaccctgcagcagaaggagcatgagcagcacatccagctg
ctcctgcagcagagccgagaccacctcggtgagggactggcggacagcaagaggcagtat
gaggcccggattcaggctctggagaaggaactgggccgccagatgtggctgaaccaggaa
ctgagacagaagctgtgcagtgtgaacgcctcaggccacagcaggggtggggagaagaga
gccctctgcctggagagcaggccagcccctggaagtgaagatgagccccacccagtgcca
gagctgctctggcagcaccccctcaatgagggagccccttgcacccgggaggaggtgcga
gacttagtccatgctccgttacccttgacatggaagcgctcgaacctatgcagcagtgag
gagcagggctcccccgacgagcagagacagtgggaggctgctgagtccctggtggggcgt
gtgctgccagtggctgaggtagccctgccctggaacttggggcccctgcccaagtcccgg
cgggaactacgaagaaccagcccaggtatgatcgatgtccggaaaaaccccctgtag

DBGET integrated database retrieval system