KEGG   Tupaia chinensis (Chinese tree shrew): 102484080
Entry
102484080         CDS       T02978                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04022  cGMP-PKG signaling pathway
tup04141  Protein processing in endoplasmic reticulum
tup04151  PI3K-Akt signaling pathway
tup04211  Longevity regulating pathway
tup04261  Adrenergic signaling in cardiomyocytes
tup04668  TNF signaling pathway
tup04728  Dopaminergic synapse
tup04911  Insulin secretion
tup04915  Estrogen signaling pathway
tup04918  Thyroid hormone synthesis
tup04925  Aldosterone synthesis and secretion
tup04926  Relaxin signaling pathway
tup04927  Cortisol synthesis and secretion
tup04928  Parathyroid hormone synthesis, secretion and action
tup04934  Cushing syndrome
tup04935  Growth hormone synthesis, secretion and action
tup05020  Prion disease
tup05030  Cocaine addiction
tup05031  Amphetamine addiction
tup05034  Alcoholism
tup05161  Hepatitis B
tup05163  Human cytomegalovirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102484080 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102484080 (ATF6B)
   04022 cGMP-PKG signaling pathway
    102484080 (ATF6B)
   04151 PI3K-Akt signaling pathway
    102484080 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102484080 (ATF6B)
   04915 Estrogen signaling pathway
    102484080 (ATF6B)
   04926 Relaxin signaling pathway
    102484080 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    102484080 (ATF6B)
   04918 Thyroid hormone synthesis
    102484080 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    102484080 (ATF6B)
   04925 Aldosterone synthesis and secretion
    102484080 (ATF6B)
   04927 Cortisol synthesis and secretion
    102484080 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102484080 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    102484080 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    102484080 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102484080 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    102484080 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    102484080 (ATF6B)
   05031 Amphetamine addiction
    102484080 (ATF6B)
   05034 Alcoholism
    102484080 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102484080 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102484080 (ATF6B)
   05161 Hepatitis B
    102484080 (ATF6B)
   05163 Human cytomegalovirus infection
    102484080 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tup03000]
    102484080 (ATF6B)
Transcription factors [BR:tup03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102484080 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 Docking NYD-SP28_assoc
Other DBs
NCBI-GeneID: 102484080
NCBI-ProteinID: XP_006154371
LinkDB
Position
Un
AA seq 696 aa
MAELMLLSEIADPTRFFTDNLLSPEDWDSTLYAGLDEVADEPTHLFRCPEQDVPFESSSL
DLGMDPSPPEPPWDLLPIIPDLQVKSEPSSPCSSSSLSSESSLLSAEPSSQTPGVGEVLR
VKAESLLPPLCLLGDSPVSPFETVQINVGPTTEEASDVQTKVEPASPSSSINSEASLSAD
SPSQAFLGEEVLEVKTEPPSPAGCLLWDVPAPSLGAVQISMGPFPDGSSGKALPARKPPL
QPKPVVLTTIPMPPRAVPPSTAVLLQPLVQPPPVSPVVLIQGAIQVQPEGAAPPIPRPER
KSIVPAPLPGNACPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLGARAALADNQQ
LRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISEPPLAPISP
TSAQEPRPRRHLLEFSEQEPAQGVEPLRRSSQSPQEPQPSPVSRPSFRNLTAFPGGAKEL
LLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRAAERQKSQLRKKSP
PVKAAPVQPLGPPERNSVGQLQLYRHPDRSQPEFLDAIDRREDTFYVVSFRRDHLLLPAI
SHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMGTRVIHIKTSTVPPSLR
KQPSPTPGNATGGPFPAPAPSQAHQASHHPLYLNHP
NT seq 2091 nt   +upstreamnt  +downstreamnt
atggcggaactgatgctcctcagcgagattgcggaccccacgcgtttcttcaccgacaac
ctgctgagcccggaggactgggacagcacgttgtatgccggcctggatgaagtggcagac
gagccgacgcacctcttccgttgcccggagcaggatgtcccgtttgaaagcagttccctg
gacttggggatggatcccagcccacctgagcccccatgggacctcctgcctatcatccca
gatcttcaggtgaaatctgagccatcctctccctgctcgtcctcctccctcagctcagaa
tcatcacttctctctgcagagccctccagccagacccccggggtaggagaggtgctgcgt
gtgaaggcagagtccttgttacctcccctctgcctcctgggagacagtccagtgtccccg
tttgaaaccgtccagatcaacgtgggccccaccactgaggaagcttcagatgtccagacc
aaggtagaacccgcctctccatcttcctccatcaattccgaggcttctctttcagcagat
tcccccagccaggctttcttaggagaggaggtgctggaggtgaagacagagccgccgtcc
cctgcagggtgcctcctttgggatgtcccagccccctcacttggagctgtccagatcagc
atgggcccattccctgatggctcctcaggcaaagccctgcccgcccggaagccgccactg
cagcccaaacctgtggtgctaaccaccatcccgatgccacccagagccgtgcctcctagc
accgcagtgctcctgcagcccctcgtccagccacccccagtgtccccagttgtcctcatc
cagggtgctattcaagttcagcctgaaggggcagccccccctattccacggcccgagagg
aagagcattgttccagcccctctgcctgggaacgcctgcccacctgaagttgatgcgaag
ctgctgaagcggcagcagcgaatgatcaagaaccgggagtcggcctgccagtcccggagg
aagaagaaggagtatctgcaggggctgggggcgcgggcggcgctggctgacaaccagcag
ctccgccgggaaaatgctgccctccggcggcggctggaggccctgctggccgagaacagc
gagctcaagttagggtctggaaaccggaaggtggtctgcatcatggtcttcctcctcttc
attgccttcaactttggacccgtcagcatcagcgagcctcctctggctcccatctctccg
acgagcgcacaggagcctcggccccggagacacttgctagagttctctgagcaagagcca
gctcagggagttgaacccctccggaggtcctcccagagccctcaggagccccagcctagc
cctgtgagccgtcccagtttcaggaacctgacggccttccctgggggcgccaaggagcta
ctgctgagagacctggaccagctcttcctctcctccgactgccggcacttcaaccggacc
gagtcgctgaggcttgccgacgagctgagtggctgggtccagcgccaccagaggggccgg
cggaagatccctcagagggccgcagaaagacagaagtctcagctacggaagaagtcacct
ccagtaaaggcagctcccgtccagcccctgggaccccctgaaaggaactctgtgggccag
ctgcagctctatcgccacccagaccgctcgcagccagagttcctggatgcaatcgaccga
cgggaggacaccttttatgttgtctccttccgaagggaccacctgcttctcccagccatc
agccacaataagacctcccggcccaagatgtccctggtcatgcctgccatggctcccaat
gagaccttgtcgggccggggggccccgggggactatgaggagatgatgcagatcgagtgt
gaggtcatgggcaccagggtgattcacatcaagacctccacggtgcccccttcgcttcga
aaacagccgtccccaaccccaggcaatgccacagggggccccttcccagctcccgcaccc
agccaggcccaccaggcctcccaccacccgctctacctcaatcacccttga

DBGET integrated database retrieval system