KEGG   Tupaia chinensis (Chinese tree shrew): 102484722Help
Entry
102484722         CDS       T02978                                 

Gene name
TUFM
Definition
(RefSeq) Tu translation elongation factor, mitochondrial
  KO
K02358  elongation factor Tu
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
KEGG Orthology (KO) [BR:tup00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:tup03012]
    102484722 (TUFM)
   03029 Mitochondrial biogenesis [BR:tup03029]
    102484722 (TUFM)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tup04147]
    102484722 (TUFM)
Translation factors [BR:tup03012]
 Eukaryotic Type
  Elongation factors
   102484722 (TUFM)
 Prokaryotic Type
   102484722 (TUFM)
Mitochondrial biogenesis [BR:tup03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    102484722 (TUFM)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102484722 (TUFM)
  Exosomal proteins of breast cancer cells
   102484722 (TUFM)
  Exosomal proteins of colorectal cancer cells
   102484722 (TUFM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 102484722
NCBI-ProteinID: XP_014443213
LinkDB All DBs
Position
Un
AA seq 455 aa AA seqDB search
MAAATLLRATPRFSGLGAATAGRTPLLQGLLRPLTAPALPLLCRGLAAEAKKVYVRDKPH
VNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYST
AARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLAKQIGVEHVV
VYVNKADAVEDTEMVELVELEIRELLSEFGYKGEEAPVIVGSALCALEQRDPELGLKSVQ
KLLDAVDTYIPVPTRDLEKPFMLPVESVYSIPGRGTVVTGTLERGILKKGDECEFLGHSK
NIRSVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSIQPHQKVEAQVY
ILSKEEGGRHKPFVSHFMPVMFSLTWDMACRVILPPGKELAMPGEDLKLNLVLRQPMILE
KGQRFTLRDGNRTIGTGLVTDTLAMTEEDKNVKWS
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgccactctgctgcgcgcgacgcctcgcttcagcggtctcggggccgctact
gcaggccggaccccactactgcagggtttgctgcgaccgctgacggctccagcgttgccc
ctgttgtgccgtggcctggccgctgaggccaagaaggtctacgtgcgcgacaagccccat
gtgaatgtgggcaccatcggccatgtggaccacggcaagaccacactgacagcggccatc
acgaagattctagcagagggaggtggggctaaattcaagaagtacgaggagattgacaat
gccccggaggagcgcgctcgaggtatcaccatcaatgcggcccacgtggagtacagcact
gctgcccgccactatgcccacacagactgccctggtcacgcagattatgttaagaatatg
atcacaggcactgcaccccttgatggctgcatcctggtggtggcagccaacgatggcccc
atgccccagacccgagagcacttactactggctaaacagattggggtagagcatgttgtg
gtgtatgtgaacaaggctgacgctgtcgaggacactgaaatggtggagctagtcgagctg
gagattcgggaactgctcagtgaattcggctacaaaggggaggaggccccggtcatcgtt
ggctctgctctctgtgcccttgagcaacgtgaccctgaactaggtctgaagtccgtgcag
aagctgctggacgctgtggacacgtacatcccagtgcccacccgggacctggagaagccc
ttcatgctgcctgtagagtcggtttactctattcctggccggggcactgtggtgacaggt
acactagagcgtggcattttgaagaagggagatgagtgtgagttcctgggacacagcaag
aacattcgcagtgtggtgacaggcattgagatgttccacaagagcctggagagggcagag
gcaggggataaccttggggcgctggtccgaggcttgaagcgggaagacctgaggcgtggc
ctggtcatggtcaagccagggtccatccagccccatcagaaggtggaggcacaggtttac
attctcagcaaggaggagggtggccgccacaaacccttcgtatcccacttcatgcctgtc
atgttctccctcacctgggacatggcctgtcgtgttatcctgcctccagggaaggagctt
gccatgcctggggaggacttgaagctcaacctagtcttgaggcagccgatgatcttagag
aagggccagcgcttcactctgcgagatggcaaccggaccatcggcactggccttgtcact
gacacgctggccatgactgaggaagacaagaacgtgaaatggagctga

DBGET integrated database retrieval system