KEGG   Tupaia chinensis (Chinese tree shrew): 102484722Help
Entry
102484722         CDS       T02978                                 

Gene name
TUFM
Definition
(RefSeq) Tu translation elongation factor, mitochondrial
  KO
K02358  elongation factor Tu
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
Translation factors [BR:tup03012]
 Eukaryotic Type
  Elongation factors
   102484722 (TUFM)
 Prokaryotic Type
   102484722 (TUFM)
Mitochondrial biogenesis [BR:tup03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    102484722 (TUFM)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102484722 (TUFM)
  Exosomal proteins of breast cancer cells
   102484722 (TUFM)
  Exosomal proteins of colorectal cancer cells
   102484722 (TUFM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 102484722
NCBI-ProteinID: XP_014443213
LinkDB All DBs
Position
Un
AA seq 455 aa AA seqDB search
MAAATLLRATPRFSGLGAATAGRTPLLQGLLRPLTAPALPLLCRGLAAEAKKVYVRDKPH
VNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYST
AARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLAKQIGVEHVV
VYVNKADAVEDTEMVELVELEIRELLSEFGYKGEEAPVIVGSALCALEQRDPELGLKSVQ
KLLDAVDTYIPVPTRDLEKPFMLPVESVYSIPGRGTVVTGTLERGILKKGDECEFLGHSK
NIRSVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSIQPHQKVEAQVY
ILSKEEGGRHKPFVSHFMPVMFSLTWDMACRVILPPGKELAMPGEDLKLNLVLRQPMILE
KGQRFTLRDGNRTIGTGLVTDTLAMTEEDKNVKWS
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgccactctgctgcgcgcgacgcctcgcttcagcggtctcggggccgctact
gcaggccggaccccactactgcagggtttgctgcgaccgctgacggctccagcgttgccc
ctgttgtgccgtggcctggccgctgaggccaagaaggtctacgtgcgcgacaagccccat
gtgaatgtgggcaccatcggccatgtggaccacggcaagaccacactgacagcggccatc
acgaagattctagcagagggaggtggggctaaattcaagaagtacgaggagattgacaat
gccccggaggagcgcgctcgaggtatcaccatcaatgcggcccacgtggagtacagcact
gctgcccgccactatgcccacacagactgccctggtcacgcagattatgttaagaatatg
atcacaggcactgcaccccttgatggctgcatcctggtggtggcagccaacgatggcccc
atgccccagacccgagagcacttactactggctaaacagattggggtagagcatgttgtg
gtgtatgtgaacaaggctgacgctgtcgaggacactgaaatggtggagctagtcgagctg
gagattcgggaactgctcagtgaattcggctacaaaggggaggaggccccggtcatcgtt
ggctctgctctctgtgcccttgagcaacgtgaccctgaactaggtctgaagtccgtgcag
aagctgctggacgctgtggacacgtacatcccagtgcccacccgggacctggagaagccc
ttcatgctgcctgtagagtcggtttactctattcctggccggggcactgtggtgacaggt
acactagagcgtggcattttgaagaagggagatgagtgtgagttcctgggacacagcaag
aacattcgcagtgtggtgacaggcattgagatgttccacaagagcctggagagggcagag
gcaggggataaccttggggcgctggtccgaggcttgaagcgggaagacctgaggcgtggc
ctggtcatggtcaagccagggtccatccagccccatcagaaggtggaggcacaggtttac
attctcagcaaggaggagggtggccgccacaaacccttcgtatcccacttcatgcctgtc
atgttctccctcacctgggacatggcctgtcgtgttatcctgcctccagggaaggagctt
gccatgcctggggaggacttgaagctcaacctagtcttgaggcagccgatgatcttagag
aagggccagcgcttcactctgcgagatggcaaccggaccatcggcactggccttgtcact
gacacgctggccatgactgaggaagacaagaacgtgaaatggagctga

DBGET integrated database retrieval system