KEGG   Tupaia chinensis (Chinese tree shrew): 102485262
Entry
102485262         CDS       T02978                                 

Gene name
MTOR
Definition
(RefSeq) mechanistic target of rapamycin
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup01522  Endocrine resistance
tup04012  ErbB signaling pathway
tup04066  HIF-1 signaling pathway
tup04072  Phospholipase D signaling pathway
tup04136  Autophagy - other
tup04140  Autophagy - animal
tup04150  mTOR signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04152  AMPK signaling pathway
tup04211  Longevity regulating pathway
tup04213  Longevity regulating pathway - multiple species
tup04218  Cellular senescence
tup04371  Apelin signaling pathway
tup04613  Neutrophil extracellular trap formation
tup04630  JAK-STAT signaling pathway
tup04659  Th17 cell differentiation
tup04714  Thermogenesis
tup04910  Insulin signaling pathway
tup04919  Thyroid hormone signaling pathway
tup04920  Adipocytokine signaling pathway
tup04930  Type II diabetes mellitus
tup04931  Insulin resistance
tup04935  Growth hormone synthesis, secretion and action
tup05010  Alzheimer disease
tup05014  Amyotrophic lateral sclerosis
tup05016  Huntington disease
tup05017  Spinocerebellar ataxia
tup05022  Pathways of neurodegeneration - multiple diseases
tup05163  Human cytomegalovirus infection
tup05165  Human papillomavirus infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05168  Herpes simplex virus 1 infection
tup05170  Human immunodeficiency virus 1 infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05210  Colorectal cancer
tup05212  Pancreatic cancer
tup05214  Glioma
tup05215  Prostate cancer
tup05221  Acute myeloid leukemia
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05230  Central carbon metabolism in cancer
tup05231  Choline metabolism in cancer
tup05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102485262 (MTOR)
   04371 Apelin signaling pathway
    102485262 (MTOR)
   04630 JAK-STAT signaling pathway
    102485262 (MTOR)
   04066 HIF-1 signaling pathway
    102485262 (MTOR)
   04072 Phospholipase D signaling pathway
    102485262 (MTOR)
   04151 PI3K-Akt signaling pathway
    102485262 (MTOR)
   04152 AMPK signaling pathway
    102485262 (MTOR)
   04150 mTOR signaling pathway
    102485262 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102485262 (MTOR)
   04136 Autophagy - other
    102485262 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    102485262 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102485262 (MTOR)
   04659 Th17 cell differentiation
    102485262 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102485262 (MTOR)
   04920 Adipocytokine signaling pathway
    102485262 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    102485262 (MTOR)
   04919 Thyroid hormone signaling pathway
    102485262 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    102485262 (MTOR)
   04213 Longevity regulating pathway - multiple species
    102485262 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    102485262 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102485262 (MTOR)
   05206 MicroRNAs in cancer
    102485262 (MTOR)
   05205 Proteoglycans in cancer
    102485262 (MTOR)
   05230 Central carbon metabolism in cancer
    102485262 (MTOR)
   05231 Choline metabolism in cancer
    102485262 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102485262 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102485262 (MTOR)
   05212 Pancreatic cancer
    102485262 (MTOR)
   05225 Hepatocellular carcinoma
    102485262 (MTOR)
   05226 Gastric cancer
    102485262 (MTOR)
   05214 Glioma
    102485262 (MTOR)
   05221 Acute myeloid leukemia
    102485262 (MTOR)
   05215 Prostate cancer
    102485262 (MTOR)
   05224 Breast cancer
    102485262 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102485262 (MTOR)
   05014 Amyotrophic lateral sclerosis
    102485262 (MTOR)
   05016 Huntington disease
    102485262 (MTOR)
   05017 Spinocerebellar ataxia
    102485262 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    102485262 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102485262 (MTOR)
   04931 Insulin resistance
    102485262 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102485262 (MTOR)
   05168 Herpes simplex virus 1 infection
    102485262 (MTOR)
   05163 Human cytomegalovirus infection
    102485262 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102485262 (MTOR)
   05165 Human papillomavirus infection
    102485262 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102485262 (MTOR)
   01522 Endocrine resistance
    102485262 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tup01001]
    102485262 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tup04131]
    102485262 (MTOR)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102485262 (MTOR)
Protein kinases [BR:tup01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   102485262 (MTOR)
Membrane trafficking [BR:tup04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    102485262 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 UME V-ATPase_H_N EPSP_synthase HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 102485262
NCBI-ProteinID: XP_006145394
LinkDB
Position
Un
AA seq 2549 aa
MLGTGPAAATAATTTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGASPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVNPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITSATTTATTAATAAATASTEGSNSESEAESTENSP
TPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN
EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS
KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG
ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL
QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL
SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL
MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH
PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDG
VELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLD
VPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7650 nt   +upstreamnt  +downstreamnt
atgcttggaactggacctgccgccgccaccgcagccaccaccacatctagcaatgtgagc
gttctgcagcagtttgccagtggcctgaagagccgaaatgaggagaccagagccaaagct
gccaaggagctccagcactatgtcaccatggagcttcgagagatgagtcaagaggaatct
actcgcttctatgatcagctaaaccatcacatttttgaactggtttccagctctgatgcc
aatgagaggaaaggtggcatcttggccatagccagcctcataggagtggaaggtggaaat
gccacccgaattggcagatttgcgaactatcttcggaacctcctcccctctaatgaccca
gttgtcatggaaatggcatccaaggccattggacgcctcgccatggcaggggacactttc
acggctgagtacgtggagtttgaggtgaagcgagccctggaatggctgggtgctgaccgc
aacgaaggccggagacacgcagctgtcctggttctccgtgagctggccatcagtgttccc
accttcttcttccagcaagtgcagcccttctttgacaacatttttgtggccgtgtgggat
cccaaacaggccattcgtgagggagctgtggctgcccttcgtgcctgtctaattctcacc
acccagcgtgagccaaaggagatgcagaagcctcagtggtacaggcacacgtttgaagaa
gcagaaaaagggtttgatgagacgttggccaaagagaagggcatgaatcgggatgatcgg
atccatggagccttgctgatcctcaacgagctggtccgaatcagcagcatggaaggagag
cgtctgagagaagaaatggaagaaatcacacagcagcagctggtacatgacaaatactgc
aaagatctcatgggctttgggacaaaacctcgtcacattactcccttcaccagcttccag
gctgtacagccccaacagtcaaatgccctggtggggctgctggggtacagctctcaccaa
ggccttatgggatttggggcttctccaagcccagcaaagtccaccctagtggagagccga
tgttgcagagacttgatggaggagaagtttgatcaggtgtgccagtgggtgctgaaatgc
aggaatagcaagaactcgctgatccaaatgacaatccttaatctgttgccccgcttggct
gcattccgaccttctgccttcacagatacccagtacctccaggataccatgaatcatgtc
ctcagctgtgtcaagaaggagaaagaacgtacagcggccttccaagccctggggctactc
tctgtggctgtgaggtccgaatttaaggtctatttgcctcgtgtgctggatatcattcga
gcagccctgcctcctaaggacttcgcccataagaggcagaaggcaatgcaggtggatgcc
acagtgttcacttgcatcagcatgctggctcgagcaatggggccaggcatccagcaggat
atcaaggagctgctggagcccatgctggcagtgggactaagccctgccctcactgctgta
ctctatgacctgagccgtcaaattccgcagctgaagaaggacatccaagacgggctactg
aagatgctctctctggtccttatgcacaaacccctccggcacccaggcatgcccaagggc
ctggcccatcagctggcctctcctggcctcacgactcttcctgaggccagtgatgtgggg
agtatcactcttgccctccgaactcttggcagctttgaattcgaaggccattctctgacc
caatttgtccgccactgtgcggatcatttcctgaacagtgagcacaaggagatccgcatg
gaagctgctcgcacctgttcacgcctgctcacaccctccatccacctcatcagtggccat
gctcatgtggttagccagactgcagtgcaagtggtagcagacgtgctcagcaaactgctc
gtggttggcataacagatcctgaccccgacatccgctactgtgtcttggcatccctggat
gagcgctttgatgcacacctggcccaggcagagaatttgcaggccctgtttgtagcactg
aatgaccaggtgtttgagatccgggaactggccatctgcactgtaggccggcttagtagc
atgaacccagcctttgtcatgcctttcctgcgcaagatgctcatccagattttgacagaa
ctggagcacagtggcattgggagaatcaaagagcagagcgcccgcatgctggggcacctg
gtctccaatgccccacgactcatccgcccctacatggagcctattctgaaggctttaatt
ttgaaactgaaagatccagatcctgatccaaacccaggggtgatcaataatgtcttggct
acaataggagaattggctcaagttagtggcctagaaatgaggaagtgggttgatgaactt
tttatcatcatcatggacatgctccaggattcctctctgttggccaaaaggcaggtggct
ctatggaccctgggacagttggtggccagtactggctatgtagtggagccctacaggaag
taccccactttgcttgaggtgctgctgaattttttaaagactgaacagaatcagggtaca
cggagagaggctatccgtgtgttggggctgttaggggctttggatccctataaacacaaa
gtgaacatcggcatgattgaccaatcccgggatgcctctgctgtcagcctatcagaatcc
aagtcaagtcaagactcctctgactacagcaccagtgaaatgctggtcaatatgggcaac
ctgcctctggatgagttctacccagctgtgtccatggtggccttgatgcggatcttccga
gaccagtctctctctcaccatcacaccatggtcgtccaggccattaccttcatcttcaag
tccctaggactcaagtgtgtacagttcctgccccaggtcatgcccacattcctgaatgtc
attagggtctgtgacggggccatccgagaatttctattccagcagttgggaatgttggtg
tccttcgtcaagagccacatcagaccttatatggatgaaatagtcaccctcatgagagaa
ttctgggtcatgaacacatcaatccagagcacgatcattcttctcattgagcagatcgtg
gtagctcttgggggtgaatttaagctctacctcccccagctaatcccacacatgctgcgt
gtcttcatgcacgacaacagcccaggccgcatcgtctccatcaagttgttggcggcaatc
cagctgtttggcgccaatctagatgactatctgcatttgttgttgcctcctattgtgaag
ttgtttgatgcccctgaagtcccactgccatctcgaaaggcagcattagagacagtggac
cgcctgacagaatccctggatttcactgactatgcctcccggatcattcaccctattgtt
cgaacactggaccagagcccagaactgcgttccacagccatggacacgttgtcctcactt
gtctttcaactggggaagaagtaccaaattttcattccaatggtgaataaagttctggtg
cgacaccgaatcaaccatcagcgctatgatgtgctcatctgcaggattgtcaaggggtac
acccttgctgatgaagaggaagatcctttgatttaccagcatcgcatgctgagaagtggc
caaggagatgcattggctagtggaccagtagaaacaggacccatgaagaaattgcacgtc
agcaccatcaacctccaaaaggcctggggagcggccaggagggtctccaaagatgactgg
ctggagtggctgagacggctgagcctggagctgctgaaggactcctcgtcaccctccctg
cgctcgtgctgggctctggcgcaggcttacaacccaatggccagggatctcttcaatgct
gcatttgtgtcctgctggtctgaactgaatgaagaccagcaggatgagcttattagaagc
atcgagttggccctcacctcacaggacatcgctgaagttacccaaacccttttaaacttg
gccgaattcatggaacacagtgacaagggccccctgccactgagagatgacaacggcatt
gttctgctgggtgagagagcagccaagtgccgagcatatgccaaagcactacactacaag
gagctggagttccagaagggtcccacccccgccattctggagtctctgatcagcattaat
aataagctacagcagcccgaggcagctgctggggtgttggaatatgccatgaaacacttt
ggagagctggagatccaggctacctggtatgagaaactgcatgagtgggaggatgctctt
gtagcctatgacaagaaaatggacaccaacaaggatgacccggagctgatgctgggccgc
atgcgctgcctcgaggccctgggggaatgggggcagctccaccagcagtgctgtgaaaag
tggaccctggttaatgatgagacccaagccaagatggcccggatggctgctgcagctgca
tggggtttaggtcaatgggacagcatggaggagtacacctgcatgatcccacgggacacc
catgacggggcattttacagagctgtgctggcactacaccaagacctcttctccttggca
caacagtgcatcgacaaggccagggacctgctggatgcggagttgactgcaatggcagga
gagagctacagtcgggcatacggggccatggtttcatgccacatgctctctgagctggag
gaggttatccagtacaaacttgtccctgagcgacgagagatcatccgccagatctggtgg
gagagactacagggttgccagcgtattgtagaggattggcagaaaatcctcatggtgcgg
tcccttgtggtcaaccctcatgaggacatgagaacctggctcaagtatgcaagcttgtgt
ggcaagagcggcaggctggctcttgcgcacaaaaccttagtgttgctcctgggagttgat
ccatctcggcaacttgatcatcccctgccaacagttcaccctcaggtgacttatgcctac
atgaaaaacatgtggaagagtgctcgcaagattgatgccttccagcacatgcagcacttc
gtccagactatgcagcagcaggcccagcatgccattgctaccgaggaccagcagcacaag
caggagctacacaagctcatggcccggtgttttctgaaactgggggagtggcagttgaac
ctacagggcatcaacgagagcacaatccccaaagtgctgcagtactacagcgccgccacg
gagcacgaccgcagctggtacaaggcctggcatgcgtgggcagtgatgaactttgaggct
gtgctacactacaaacatcaaaaccaagcccgtgatgagaagaagaaactgcgtcatgcc
agcggggccaacatcaccagtgccaccactactgccaccacagctgctaccgctgctgcc
actgccagcactgaaggcagcaacagcgagagtgaggccgagagcaccgagaacagcccc
accccatctcctctgcagaagaaggtcactgaggatttgtccaaaacgctcttgatgtac
actgtccctgccgtccagggcttcttccgttctatctcattgtcacgaggcaacaacctc
caggatacactcagagtccttacattatggtttgattatggtcactggcctgacgtcaac
gaagccttagtggaaggggtgaaagcaatccagattgatacttggttacaggttatacct
cagctcattgcaagaattgatacgcccagacccttggtgggacgcctcattcaccagctt
ctcacagacattggtcggtaccacccccaggccctcatctaccccttgactgtggcttct
aagtctaccaccacagcccgtcacaatgcagccaacaagatcctgaagaacatgtgtgag
cacagtaacaccctggtccagcaggccatgatggtgagtgaggagctgatccgagtggcc
atcctctggcacgagatgtggcacgaaggcctggaagaggcatctcgtttgtactttggg
gagaggaatgtgaaaggcatgtttgaggtgctggagcctctgcatgctatgatggaacgg
ggcccccagactctgaaagaaacgtcatttaatcaggcctatggtcgagatttaatggag
gcacaagaatggtgtaggaagtacatgaaatcaggaaatgtcaaggacctcacccaagcc
tgggacctctattatcacgtgttcagacgaatctcaaaacagctgcctcagctcacatcc
ttagagctgcaatatgtttccccaaaacttctgatgtgccgggaccttgagttggctgtg
ccaggaacctatgaccccaaccagccgatcattcgcattcagtccatagcaccatctttg
caagtcattacatccaagcagaggccccggaagttgacactgatgggcagcaatggacat
gagtttgttttcctcctgaaaggccacgaagatctgaggcaggatgaacgggtgatgcag
ctctttggcctggttaacactcttctggccaatgacccaacatctcttcggaaaaacctc
agcatccaaagatatgccgtcattcctctgtcgaccaactctggcctcattggctgggtc
cctcactgcgacacactgcatgccctcatccgagactacagggagaaaaagaagattctt
ctcaacattgagcatcgcataatgttgcggatggctccagactatgaccacttgactctg
atgcagaaggtggaggtatttgagcacgctgtcaataacaccgccggagacgacctggcc
aagctgctgtggctgaagagccctagctcagaggtttggtttgaccgaagaaccaattat
acccgctcattagcagtcatgtcaatggttgggtatattctgggcctaggagataggcac
ccatcaaacctgatgctggacaggctgagtgggaaaatcctgcacattgactttggggac
tgctttgaggttgctatgaccagagagaagtttccagagaagattccatttagactaaca
agaatgttgaccaatgctatggaggttactggcctagatggcaactataggatcacatgc
cacacggtgatggaagtacttcgggagcacaaggacagcgtcatggctgtgctggaagcc
ttcgtctatgaccccttgctgaactggaggctgatggacacaaataccaaaggcaataag
agatcccgaacgaggacagattcctactctgctggccagtcagtagaaattttggacggt
gtggaacttggagaaccagcccataagaaaacggggaccacagtgccagaatccattcat
tcgttcattggagatggtttggtgaagccagaggccctaaataagaaagctattcaaatt
attaacagggttcgagataagctcactggtcgggatttctctcatgatgatactttggat
gttcccacacaagttgagctgctcatcaaacaagcaacatcccatgaaaacctctgtcag
tgctacattggctggtgtcctttctggtaa

DBGET integrated database retrieval system