KEGG   Tupaia chinensis (Chinese tree shrew): 102485304
Entry
102485304         CDS       T02978                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup01522  Endocrine resistance
tup04010  MAPK signaling pathway
tup04012  ErbB signaling pathway
tup04014  Ras signaling pathway
tup04015  Rap1 signaling pathway
tup04020  Calcium signaling pathway
tup04066  HIF-1 signaling pathway
tup04068  FoxO signaling pathway
tup04072  Phospholipase D signaling pathway
tup04144  Endocytosis
tup04151  PI3K-Akt signaling pathway
tup04510  Focal adhesion
tup04520  Adherens junction
tup04540  Gap junction
tup04630  JAK-STAT signaling pathway
tup04810  Regulation of actin cytoskeleton
tup04912  GnRH signaling pathway
tup04915  Estrogen signaling pathway
tup04921  Oxytocin signaling pathway
tup04926  Relaxin signaling pathway
tup04928  Parathyroid hormone synthesis, secretion and action
tup04934  Cushing syndrome
tup05160  Hepatitis C
tup05163  Human cytomegalovirus infection
tup05165  Human papillomavirus infection
tup05171  Coronavirus disease - COVID-19
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05210  Colorectal cancer
tup05212  Pancreatic cancer
tup05213  Endometrial cancer
tup05214  Glioma
tup05215  Prostate cancer
tup05218  Melanoma
tup05219  Bladder cancer
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05230  Central carbon metabolism in cancer
tup05231  Choline metabolism in cancer
tup05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102485304 (EGFR)
   04012 ErbB signaling pathway
    102485304 (EGFR)
   04014 Ras signaling pathway
    102485304 (EGFR)
   04015 Rap1 signaling pathway
    102485304 (EGFR)
   04630 JAK-STAT signaling pathway
    102485304 (EGFR)
   04066 HIF-1 signaling pathway
    102485304 (EGFR)
   04068 FoxO signaling pathway
    102485304 (EGFR)
   04020 Calcium signaling pathway
    102485304 (EGFR)
   04072 Phospholipase D signaling pathway
    102485304 (EGFR)
   04151 PI3K-Akt signaling pathway
    102485304 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102485304 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102485304 (EGFR)
   04520 Adherens junction
    102485304 (EGFR)
   04540 Gap junction
    102485304 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102485304 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102485304 (EGFR)
   04915 Estrogen signaling pathway
    102485304 (EGFR)
   04921 Oxytocin signaling pathway
    102485304 (EGFR)
   04926 Relaxin signaling pathway
    102485304 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    102485304 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102485304 (EGFR)
   05206 MicroRNAs in cancer
    102485304 (EGFR)
   05205 Proteoglycans in cancer
    102485304 (EGFR)
   05230 Central carbon metabolism in cancer
    102485304 (EGFR)
   05231 Choline metabolism in cancer
    102485304 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102485304 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102485304 (EGFR)
   05212 Pancreatic cancer
    102485304 (EGFR)
   05225 Hepatocellular carcinoma
    102485304 (EGFR)
   05226 Gastric cancer
    102485304 (EGFR)
   05214 Glioma
    102485304 (EGFR)
   05218 Melanoma
    102485304 (EGFR)
   05219 Bladder cancer
    102485304 (EGFR)
   05215 Prostate cancer
    102485304 (EGFR)
   05213 Endometrial cancer
    102485304 (EGFR)
   05224 Breast cancer
    102485304 (EGFR)
   05223 Non-small cell lung cancer
    102485304 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102485304 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102485304 (EGFR)
   05171 Coronavirus disease - COVID-19
    102485304 (EGFR)
   05163 Human cytomegalovirus infection
    102485304 (EGFR)
   05165 Human papillomavirus infection
    102485304 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102485304 (EGFR)
   01522 Endocrine resistance
    102485304 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tup01001]
    102485304 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tup04147]
    102485304 (EGFR)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102485304 (EGFR)
Protein kinases [BR:tup01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   102485304 (EGFR)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102485304 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   102485304 (EGFR)
  Exosomal proteins of bladder cancer cells
   102485304 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH GAPT Kdo
Other DBs
NCBI-GeneID: 102485304
NCBI-ProteinID: XP_006148980
LinkDB
Position
Un
AA seq 1246 aa
MVIQQQKIKAPEAPRRLQYANQATVCSDHYWPQAGPSQEQRWPLLWEQGQPGRHSCDVAA
AGDHGEVCQGTSNRLTQLGTFEDHFLSLQRILNNCEVVLGNLEITYVQRNYDLSFLKTIQ
EVAGYVLIALNTVERIPLENLQIIRGNVLYENSYALAVLSNYGANKTGLRELPMRNLQEI
LHGAVRFSNNPFLCNVESIQWRDIVNVNFLSNMSLDFRSHSSSCQKCNPGCPNGSCWGAG
EENCQKLTKVICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDT
CPPLMLYNPTTYQMDVNSEGKYSFGATCVKKCPRNYVVTDHGSCVRACGPDSYEMEEDGV
RKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIKHFKNCTSISGDLHILPVAFKGDSFTR
TPPLDPKELDILKTVKEITGFLLIQAWPGNRTDLHAFENLEIIRGRTKQHGQFSLAVVGL
NITSLGLRSLKEISDGDVIISGNPNLCYADTISWKTLFGTSSQKTKIMNNREENSCKTTD
HICNALCSSEGCWGPEARDCVSCRNVSRGKECVERCNVLEGEPREFVENSECIQCHPECL
PQDMNITCTGRGPDNCIKCAHFIDGPHCVKTCPAGIMGENNTLVWKYADANRVCHLCHSN
CTYGCAGPGLEGCSINGPKIPSIATGIVGGLLLLLLVALGIGLFLRRRHIVRKRTLRRLL
QERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVA
IKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVR
EHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLG
AEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEI
SSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQG
DERMHLPSPTDSNFYRALMDEEDMEDVVDADEYLIPQQGFFNSPSTSRTPLLSSLSVTSN
NSTVACIDRNGQSYPVKEDSFIQRYSSDPTGALTEDNIDDIFLPVPEYINQSVPKRPAGS
VQNPVYHNQPLNPAPGRDPHYQNPHSNAVDNPEYLNTAQPTCVNSVFDSPAHWAQKSNHQ
ISLDNPDYQQDFFPKEAKPNGIFKGPAAENAEYLRVAPPSSEFIGA
NT seq 3741 nt   +upstreamnt  +downstreamnt
atggtcattcagcagcagaaaatcaaggcaccagaagcccctagacggctgcagtatgca
aatcaggccacggtctgcagtgaccactactggccccaggcagggccctcccaggagcag
aggtggcccctgctgtgggagcagggccagccagggcggcacagctgtgatgtggcagca
gctggcgaccacggggaagtttgccagggcaccagtaacaggctcacacagttgggcacc
tttgaagatcacttcctgagcctccagaggatactgaataactgtgaagtggtccttgga
aatttggaaatcacctacgtgcaaaggaattacgacctttccttcttaaagaccattcag
gaggttgctggttatgtcctcattgccctgaacacagtggagaggatccccttggaaaac
ttgcagatcatcagaggaaatgtgctctatgaaaactcctatgccctggcagtcttgtcc
aactatggtgcaaataaaactggactaagggagctgcccatgaggaacttacaggaaatc
ctgcatggtgctgtgcgattcagcaacaaccccttcctctgcaacgtggagtccatccag
tggcgggacatcgtcaacgtcaacttcctgagcaatatgtcactggacttccggagccat
tcaagcagttgccagaagtgcaatccgggctgtcctaatggaagctgctggggtgcaggc
gaagaaaactgccagaagctgaccaaagtcatctgtgcccagcagtgttcggggcgctgc
cgcggcaagtcccccagtgactgctgtcacaaccagtgtgctgccggctgcaccgggccc
cgtgagagcgactgcctggtctgccgcaagttccgagatgaagccacgtgcaaggacacg
tgtcccccgctcatgctatacaaccctaccacgtaccagatggacgtcaactccgagggg
aagtacagctttggtgccacctgtgtgaagaaatgcccccgtaactacgtggtgacagat
cacggctcgtgcgtccgcgcctgcggacctgacagctacgagatggaggaagatggcgtc
cgcaagtgcaaaaagtgcgaagggccttgtcgcaaagtgtgtaacggaataggaattggt
gaattcaaagatacgctttccataaatgctacaaatatcaaacacttcaaaaactgcacc
tccatcagcggagatctgcacatcctgccggtcgcatttaagggcgactccttcacacgc
actcctcctctggatccgaaggaactggacattctaaaaaccgtaaaggaaataacaggg
ttcttgctgatccaggcatggcctggaaacaggactgacctacatgctttcgagaaccta
gaaatcattcgcggcaggacaaagcaacatggtcagttttctctcgcagttgttggcctg
aacataacgtccttgggattacggtccctcaaggagatcagtgatggagatgtgatcatt
tcgggaaacccaaatttgtgctatgcagacacaatcagctggaaaacactgtttgggacc
tccagtcagaaaaccaaaattatgaacaacagagaggaaaacagctgcaagaccacagac
cacatctgtaacgcgttatgctcctcagagggctgctggggtccggaggccagggactgt
gtctcctgccgaaacgtcagccgtggcaaggagtgtgtggagaggtgcaacgtgctggag
ggagagccgcgggagttcgtggagaattccgagtgtatccagtgccatccggaatgtctg
ccccaggacatgaacataacctgcacgggacggggaccagacaactgcatcaagtgtgcc
cacttcattgatggccctcactgtgtcaagacctgcccagctggaatcatgggagaaaat
aacaccctggtctggaagtacgccgatgccaaccgcgtatgtcacctgtgccattccaac
tgcacctatggatgtgctgggccaggtcttgaaggctgttcaatcaatgggcccaagatc
ccttccatcgccaccgggattgtgggcggcctcctcttgctgctgctggtggccctcggg
atcggccttttcctgcgcaggcgccacatcgtccggaagcgcaccctgcgccgactgctg
caggaaagagagctcgttgagcctctcacgcccagtggagaagctcccaaccaggctctc
ttgaggatcttaaaggaaacggaattcaaaaagatcaaagtgctgggttctggagcgttc
ggtactgtgtacaagggactctggatcccagaaggtgagaaagttaaaattcctgtggcc
atcaaggaattgagagaagcgacgtctccaaaagccaacaaggaaatcctcgatgaggcc
tatgtgatggccagcgtggacaatccccatgtgtgccggctcctgggcatctgcctgacc
tccacagtccagctcatcacacagctcatgcccttcggctgcctcctggactacgtccgt
gagcacaaggacaacataggctcccagtacctcctcaactggtgtgtgcagattgccaag
ggaatgaactacctggaagaccggcgcttggtgcaccgtgacctggcagccaggaatgtc
ctggtgaagaccccacagcatgtgaagatcacagattttgggttggccaaactgcttggt
gctgaagagaaggaatatcatgcagaaggaggcaaagtgcccatcaagtggatggccttg
gaatcgattttacaccgcatctatacccaccaaagtgatgtctggagctatggagtcact
gtttgggagttgatgacctttgggtccaagccttatgacgggatccctgcaagtgagatc
tcgtcgatcctggagaaaggggagcgtctgccgcagccacccatatgcaccatcgacgtc
tacatgatcatggtcaagtgctggatgatagatgcagacagtcgccctaagttccgagaa
ttgatcatcgaattctccaaaatggcccgagacccccaacgttaccttgtcattcagggg
gatgaaagaatgcacctgccgagccctacagactccaacttctaccgggccctgatggac
gaagaggacatggaagacgtcgtagacgctgacgagtacctcatcccacagcagggcttc
ttcaacagcccttccacctcccgcactcccctcttgagttctctgagtgtgaccagcaac
aactccaccgtggcttgcatcgacagaaatgggcagagctaccctgtcaaagaagacagc
ttcatccagcgctacagctcagaccccactggtgccttgactgaggacaacatagatgac
atcttccttccagtgccagaatacataaaccagtcggttcccaaaaggcctgcaggctct
gtgcagaatcctgtctatcacaatcagcctctgaatcctgctcctgggagagacccacac
taccaaaacccccacagcaatgcagtggacaaccctgagtatctcaacaccgcccagcct
acctgtgtcaacagtgtatttgacagccctgcccactgggcccagaaaagcaaccaccag
attagcctggacaaccctgactaccaacaggacttctttcccaaggaagctaagccaaat
ggtatctttaagggtcctgcagctgaaaatgcagaatacctaagggtagcaccaccgagc
agtgaattcattggagcgtga

DBGET integrated database retrieval system