KEGG   Tupaia chinensis (Chinese tree shrew): 102486503Help
Entry
102486503         CDS       T02978                                 

Gene name
MICAL1
Definition
(RefSeq) microtubule associated monooxygenase, calponin and LIM domain containing 1
  KO
K19947  F-actin monooxygenase [EC:1.14.13.225]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
KEGG Orthology (KO) [BR:tup00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tup04131]
    102486503 (MICAL1)
Enzymes [BR:tup01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.225  F-actin monooxygenase
     102486503 (MICAL1)
Membrane trafficking [BR:tup04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    102486503 (MICAL1)
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    102486503 (MICAL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3585 CH FAD_binding_3 FAD_binding_2 Pyr_redox_2 LIM DAO Pyr_redox_3 HI0933_like NAD_binding_8 FAD_oxidored GIDA Pyr_redox CAMSAP_CH NAD_binding_7 Thi4 Lycopene_cycl AlaDh_PNT_C ThiF
Motif
Other DBs
NCBI-GeneID: 102486503
NCBI-ProteinID: XP_006157041
LinkDB All DBs
Position
Un
AA seq 1065 aa AA seqDB search
MASPTSTNPAHAHFESFLQAQQCQDVLSSFQGLCEALGLEPGGGLPQYHKIKAQLNYWSA
KSLWAKLDKRASQPVYKQGQACTSTKCLVVGAGPCGLRAAVELALLGARVVLVEKRSKFS
RHNVLHLWPFTIHDLRALGAKKFYGRFCTGTLDHISIRQLQLLLLKVALLLGVEIHWRVA
FTGLQPPPRKGSGWRAQLQPSPPVQLANYEFDVLISAAGGKFVPEGFTVREMRGKLAIGI
TANFVNGRTVEETQVPEISGVAKIYNQSFFQSLLKTTGIDLENIVYYKDDTHYFVMTAKK
QCLLRLGVLRQDWPETDRLLDSANVVPEALQRFARAAADFATHGKLGKLEFAQDARGQPD
VSAFDFTSMMRAESSARVQEKHGARLLLGLVGDCLVEPFWPLGTGVARGFLAAFDAAWMV
KRWAEGAGPLEVLAERESLYQLLSQTSPENMHRNVAQYALDPATRYPNLNLRAVTPNQVR
DLYDVVAKEPVRRKIDETDSGKPATGAQEELLRWCQEQTTGYPGVHVTDLSSSWADGLAL
CALVPRLQPSLLEPSELQGVGALEATARALKMAEHELGITPVLSAQAVVAGSDPLGLIAY
LSHFHSAFKSASHSPDPASQTSPGTSSAILFLGKLQRTLQRTRSKENREDTGGKRARLEA
ETETPSTEEQPVPEFGVPQVTPSQPQEADSGDLCALCGGHLYVLERLCADGHFFHRSCFR
CHICEATLWPAGYGRHPGDGHYYCLQHLPQPGHKEDGSDKGPETPELPLPGENCMPPNPS
TPTAPQEGASPVPVPSQPTRRLIRLSSPERQRLSSLNLSPDPEMEPPPKPPRSCSALARH
ALEGSFMGWGIPSQRPQDLVVIEKEEEGLSSSEEEEEEEDVALDSDMEQALLILAKNSPT
TNKYPTWHRTLLRRAKEEEMKRFCKAQSIQRRLNEIEAALRELEAEGVKLELAMRRQSSS
PEQQKKLWLEQLLQLVQKKNSLVAEEAELMITVQELNLEEKQGQLDRELRGYINREETLK
TAADRQAEAQVLQKLVDVVNQRDALIRFQEERRLSELALGTGAQG
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atggcttcacccacttccaccaacccagctcacgcccactttgagagcttcctgcaggcc
cagcagtgccaggatgtgctgagcagcttccaggggctatgtgaggccctggggctggag
cctggtggcggtctgccccagtaccacaagatcaaggcccagcttaactactggagtgcc
aagtcgctgtgggccaagctggacaagcgagcgagccagcctgtctacaagcagggccag
gcctgcaccagcaccaagtgcctggtggtgggcgctggaccttgtgggctgcgtgctgct
gtggagctggcactgctgggggctcgtgtggtgctggtagaaaagcgctccaagttctct
cgccacaacgtgctccacctctggcccttcaccatccatgacctgcgggcactgggtgcc
aagaagttctatggacgcttttgcaccggcaccctggaccatatcagcatccggcagctt
cagctgcttctgctgaaggtggcattactgctgggggtggaaattcactggcgcgttgcc
ttcactggcctccagccccctcccagaaagggaagtggctggcgtgcccagctccagccc
agcccccctgtccagctggccaactatgaattcgatgttctcatctcagctgcaggaggc
aaattcgtgcccgaaggcttcacagtgcgagaaatgcgcggcaaactggctattggcatc
acggccaactttgtgaatggacgcaccgtggaggagacgcaggtgcccgagatcagtggt
gtggccaagatctacaaccagagcttcttccagagcctgctgaaaaccacaggcattgat
ctggaaaatattgtgtactacaaagatgacacccactacttcgtgatgacggccaagaag
cagtgtctgctgcggctgggagtgctgcgtcaggactggccggagactgatcgcctgctg
gacagtgccaatgtggtgcccgaggctctgcagcgctttgccagagcggctgctgatttc
gccacccatggcaagctcgggaagctggagtttgcccaggatgcccgtgggcagcctgac
gtctctgcctttgatttcacaagcatgatgcgggcagagagttctgctcgtgtgcaagag
aaacatggcgctcgcctcctgctgggactggtgggggactgtctggtggagcccttctgg
ccgctgggcactggagtggcccggggcttcttggcagcctttgatgcagcctggatggtg
aagcggtgggcagaaggcgctgggcccctggaagtgttggctgagcgcgagagcctatac
cagctcctgtcacagacatccccagaaaacatgcaccgaaatgtggcccagtatgccctg
gacccagccacccgctaccccaacctgaacctccgggctgtaactcccaatcaggtccga
gacctgtatgatgtggtggccaaggagcctgtgcggaggaagattgatgagacggactcg
gggaagccagccactggtgcccaggaggagctactacgctggtgccaggaacagacgact
gggtacccaggagtccatgtcaccgacctatcttcgtcctgggctgacgggctagctctg
tgtgccctggtaccccggctgcagcccagcctgctggaaccctctgagctgcagggggtg
ggggctctggaggccacagctcgggcgctgaagatggcagagcatgagctgggcatcacg
ccggtgttgtctgcacaggctgtggtggcaggaagtgacccactgggcctcatcgcctac
ctcagccatttccacagtgccttcaagagtgcatcacatagcccagaccctgccagccaa
acctccccagggacctccagtgccatactattccttggcaaactccagaggactctgcaa
cggacccgttccaaggaaaatagagaagataccggtggcaagagggctcgcttggaggca
gagactgagaccccaagtactgaggagcaacctgtcccagagtttggtgtaccccaggta
accccatctcaaccccaggaggccgattcaggggacctgtgtgcactctgtggggggcac
ctctacgtcctggaacgtctctgtgcagatggccattttttccaccggagctgcttccgc
tgtcatatctgtgaggccacgctatggccagctggctatggacggcacccaggagacgga
cattactactgcctccagcacctgccccagccaggccacaaagaggatggcagtgacaaa
ggtcccgagactccggagcttcccctaccaggtgagaattgcatgccaccaaatccctcg
actcccacagccccacaggagggagccagtcccgttccagttcctagccagcccacccgt
cggctgatccgcctctccagtccagaacgccagcggctgtcctcccttaacctatcccct
gacccggaaatggagcctccacccaagccccctcgcagctgctccgccttggcccgccat
gccctagaaggcagctttatgggttggggcataccaagccagagacctcaagatcttgta
gtcatagagaaagaggaagagggtctctcctccagtgaagaggaagaagaggaagaggat
gtagctttggactcagacatggagcaggccctgctgatcttggccaagaactcgcctacc
acgaacaagtacccaacatggcaccggactctgctgcgccgtgctaaggaagaggagatg
aagaggttctgcaaagcccagtccatccaacggcgactaaatgagatcgaggctgctctg
agggagctggaggctgagggcgtgaagctggagctggccatgaggagacagagcagttcc
ccagagcagcaaaagaaactgtggttagaacagctgctgcagctcgttcagaagaaaaac
agcctggtggctgaggaggctgagctcatgatcacagtgcaggagctgaacctggaggag
aaacaggggcagctggaccgggagctacgaggctacataaaccgggaagaaaccctgaag
acagctgcggatcggcaggctgaggcccaggtcctgcagaagctggtggacgtggtgaac
cagcgagatgccctcatccgtttccaggaggaacgcaggcttagtgagctggccttgggg
acaggggctcagggctag

DBGET integrated database retrieval system