KEGG   Tupaia chinensis (Chinese tree shrew): 102486785Help
Entry
102486785         CDS       T02978                                 

Gene name
PFKP
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00010  Glycolysis / Gluconeogenesis
tup00030  Pentose phosphate pathway
tup00051  Fructose and mannose metabolism
tup00052  Galactose metabolism
tup01100  Metabolic pathways
tup01200  Carbon metabolism
tup01230  Biosynthesis of amino acids
tup03018  RNA degradation
tup04152  AMPK signaling pathway
tup05230  Central carbon metabolism in cancer
Module
tup_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102486785 (PFKP)
   00030 Pentose phosphate pathway
    102486785 (PFKP)
   00051 Fructose and mannose metabolism
    102486785 (PFKP)
   00052 Galactose metabolism
    102486785 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    102486785 (PFKP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102486785 (PFKP)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    102486785 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tup01009]
    102486785 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:tup03019]
    102486785 (PFKP)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     102486785 (PFKP)
Protein phosphatases and associated proteins [BR:tup01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102486785 (PFKP)
Messenger RNA biogenesis [BR:tup03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     102486785 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 102486785
NCBI-ProteinID: XP_006141394
LinkDB All DBs
Position
Un
AA seq 788 aa AA seqDB search
MDDKASSAPLRKLLENLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIYEG
YQGMVDGGTNIVEADWESVSSILQVGGTIIGSARCKAFRTREGRLKAACNLVQLGITNLC
VIGGDGSLTGANIFRSEWNGLLEELAQNGKIDKEAVHKYAYLNVVGMVGSIDNDFCGTDM
TIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLPESP
PEEGWEDSMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEKIKELVVTQLGYDTRVT
ILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPETPACVVSLSGNHAVRLPLMECVQM
TQDVQKAMDERRFKDAVQLRGRSFEGNLNTYKRLAIKLPDDQIPKSNCNVAVINVGAPAA
GMNAAVRSAVRVGIADGHKMLAIYDGFDGFAKGQIKEIGWGDVGGWTGQGGSILGTKRTL
PGKNLEEIAAQMRAHNINALLIIGGFEAYLGLLELSAARERHEEFCVPMVMVPATVSNNV
PGSDFSIGADTALNTITDTCDRIKQSASGXXXXXXXIETMGGYCGYLANMGGLAAGADAA
YIFEEPFDIRDLQSNVEHLTEKMKTSIQRGLVLRNESCSENYTTDFIYQLYSEEGKGVFD
CRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITTKLREAQGKGRKFVNDDSICVLGIS
KRTLLFQPVAELKKETDFEHRIPKEQWWLKLRPLMKILAKYKASYDVSDSGQLEHVHPSS
DHGEPAAI
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggacgacaaagcctcctcggctcccctccggaagttactggagaacctctccggggct
ggcaaagccatcggcgtgctgaccagcggaggagatgcccaaggtatgaatgcagctgtc
cgcgctgtggtgcgcatggggatatacgtgggggccaaggtgtactttatatacgagggt
taccaaggcatggtagatggagggactaatattgtggaagccgactgggagagtgtatcg
agcatcctgcaagtgggcggaaccattattggcagtgcccgttgcaaagcctttcgtact
cgggaaggtcgcttaaaggctgcttgcaacctggtgcagctgggcattacgaacttgtgc
gtgattggtggggatggaagtctcacaggggccaacatcttccgctcagagtggaacgga
ctgctggaggagctggcgcagaatggtaagatcgacaaagaggctgtgcataagtacgct
tacctcaatgtggttggcatggtgggctccatcgacaatgacttctgtggcacggacatg
actatcggcacggactccgccttgcacagaatcattgaagtcgttgacgccatcatgacc
actgcccagagccaccagaggaccttcgttctcgaggtgatggggagacactgtgggtat
ctagccctggtgagtgccttagcctgtggtgccgactgggtgttccttccagaatctcca
ccagaagaaggttgggaggacagtatgtgcgtcaaactctcagagaaccgtgcccgaaaa
aaaaggctgaatattatcattgtggctgagggagcaatcgatacccaaaacaaacctatt
acctctgagaaaatcaaggagcttgtagtcacccagctgggctatgacactcgggtgacc
attctcggacatgtgcagagaggagggactccctcagcgtttgacaggattttggccagt
cgcatgggagtggaagcagtcatcgcgctgctggaagccacccctgagacccccgcttgc
gtcgtgtcgctgagtggaaaccatgccgtgcgcctgcccctgatggagtgtgtgcagatg
acccaggatgtacaaaaggcgatggatgaacgaagatttaaagatgctgtccaactccga
gggaggagctttgagggcaacctgaacacctataagcggcttgccatcaagttgcctgat
gaccagatcccaaagagcaattgcaatgtggctgtcatcaatgtgggagcacctgcagct
gggatgaatgctgccgtgcgctcggctgtgcgagtgggcatcgccgatggtcacaaaatg
ctcgcaatctatgatggctttgatggctttgccaaaggacagatcaaagaaatcggctgg
ggagatgttggaggttggaccggccaaggagggtctattcttgggacaaaacgtactctg
cctggaaagaacttggaggagatcgctgcacagatgcgggcccataatatcaatgccctg
ttgattattggtgggtttgaggcctacctgggactccttgagctgtcagctgcccgggag
agacacgaggagttctgtgtccctatggttatggttcctgccactgtctccaacaatgta
cctggttccgatttcagcatcggggcagacacagctctgaacaccatcacggatacgtgt
gaccgcatcaagcagtcggccagtggnnnnnnnnnnnnnnnnnnnnncattgagaccatg
ggaggttactgcggctacctggccaacatgggggggcttgcagccggagctgatgccgcc
tacatttttgaagagccatttgatatcagagatctgcagtctaatgtggagcacctgaca
gagaaaatgaagacctccattcaaagaggccttgtgctcagaaatgagagctgcagtgag
aactacaccaccgacttcatctaccagctctattcagaagaaggcaaaggcgtgtttgac
tgtaggaagaacgtgctgggccacatgcagcagggtggggcaccatctccgtttgacaga
aactttggaaccaaaatctctgccagagctatggagtggatcaccacaaaactgagagaa
gcccagggcaaaggaagaaaatttgttaatgatgactccatttgtgtgctgggaataagc
aaaagaaccctccttttccaacctgtagcagagctgaagaaggaaacggattttgagcac
agaattcccaaagaacagtggtggctgaaactgcggcccctcatgaagatcctggccaag
tacaaggctagctacgacgtgtctgactcgggccagctggagcatgtgcatcccagcagc
gaccacggagagcctgcggccatctga

DBGET integrated database retrieval system