KEGG   Tupaia chinensis (Chinese tree shrew): 102487039
Entry
102487039         CDS       T02978                                 

Gene name
RHOA
Definition
(RefSeq) ras homolog family member A
  KO
K04513  Ras homolog gene family, member A
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04014  Ras signaling pathway
tup04015  Rap1 signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04062  Chemokine signaling pathway
tup04071  Sphingolipid signaling pathway
tup04072  Phospholipase D signaling pathway
tup04144  Endocytosis
tup04150  mTOR signaling pathway
tup04270  Vascular smooth muscle contraction
tup04310  Wnt signaling pathway
tup04350  TGF-beta signaling pathway
tup04360  Axon guidance
tup04510  Focal adhesion
tup04520  Adherens junction
tup04530  Tight junction
tup04611  Platelet activation
tup04621  NOD-like receptor signaling pathway
tup04625  C-type lectin receptor signaling pathway
tup04660  T cell receptor signaling pathway
tup04670  Leukocyte transendothelial migration
tup04722  Neurotrophin signaling pathway
tup04810  Regulation of actin cytoskeleton
tup04921  Oxytocin signaling pathway
tup04928  Parathyroid hormone synthesis, secretion and action
tup04972  Pancreatic secretion
tup05100  Bacterial invasion of epithelial cells
tup05132  Salmonella infection
tup05133  Pertussis
tup05135  Yersinia infection
tup05152  Tuberculosis
tup05163  Human cytomegalovirus infection
tup05200  Pathways in cancer
tup05203  Viral carcinogenesis
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05210  Colorectal cancer
tup05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102487039 (RHOA)
   04015 Rap1 signaling pathway
    102487039 (RHOA)
   04310 Wnt signaling pathway
    102487039 (RHOA)
   04350 TGF-beta signaling pathway
    102487039 (RHOA)
   04072 Phospholipase D signaling pathway
    102487039 (RHOA)
   04071 Sphingolipid signaling pathway
    102487039 (RHOA)
   04024 cAMP signaling pathway
    102487039 (RHOA)
   04022 cGMP-PKG signaling pathway
    102487039 (RHOA)
   04150 mTOR signaling pathway
    102487039 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102487039 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102487039 (RHOA)
   04520 Adherens junction
    102487039 (RHOA)
   04530 Tight junction
    102487039 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102487039 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102487039 (RHOA)
   04621 NOD-like receptor signaling pathway
    102487039 (RHOA)
   04625 C-type lectin receptor signaling pathway
    102487039 (RHOA)
   04660 T cell receptor signaling pathway
    102487039 (RHOA)
   04670 Leukocyte transendothelial migration
    102487039 (RHOA)
   04062 Chemokine signaling pathway
    102487039 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102487039 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    102487039 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102487039 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    102487039 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102487039 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    102487039 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102487039 (RHOA)
   05206 MicroRNAs in cancer
    102487039 (RHOA)
   05205 Proteoglycans in cancer
    102487039 (RHOA)
   05203 Viral carcinogenesis
    102487039 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102487039 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102487039 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102487039 (RHOA)
   05135 Yersinia infection
    102487039 (RHOA)
   05133 Pertussis
    102487039 (RHOA)
   05152 Tuberculosis
    102487039 (RHOA)
   05100 Bacterial invasion of epithelial cells
    102487039 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102487039 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tup04131]
    102487039 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tup04147]
    102487039 (RHOA)
   04031 GTP-binding proteins [BR:tup04031]
    102487039 (RHOA)
Membrane trafficking [BR:tup04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    102487039 (RHOA)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102487039 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   102487039 (RHOA)
  Exosomal proteins of colorectal cancer cells
   102487039 (RHOA)
  Exosomal proteins of bladder cancer cells
   102487039 (RHOA)
GTP-binding proteins [BR:tup04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    102487039 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 102487039
NCBI-ProteinID: XP_006171021
LinkDB
Position
Un
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggcaagacgtgc
ttgctcatagtcttcagcaaggaccagttcccagaggtgtatgtgcccacggtgttcgag
aactacgtggcagacatcgaggtggacgggaagcaggtagagttggctttatgggacaca
gctgggcaggaagattacgatcgcctgaggcccctgtcctacccagacaccgacgtgata
ctgatgtgcttctctatcgacagccctgatagcttagaaaacatcccagagaagtggact
ccggaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaacaagaaggac
cttcggaatgacgagcacacacggcgggagctggccaagatgaagcaggagccggtaaaa
cctgaagagggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagggaggttttcgaaatggccacgagagcagctctgcaa
gccagacgtgggaagaagaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system