KEGG   Tupaia chinensis (Chinese tree shrew): 102487370
Entry
102487370         CDS       T02978                                 

Gene name
BIRC5
Definition
(RefSeq) baculoviral IAP repeat containing 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01524  Platinum drug resistance
tup04210  Apoptosis
tup04215  Apoptosis - multiple species
tup04390  Hippo signaling pathway
tup05161  Hepatitis B
tup05200  Pathways in cancer
tup05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102487370 (BIRC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102487370 (BIRC5)
   04215 Apoptosis - multiple species
    102487370 (BIRC5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102487370 (BIRC5)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102487370 (BIRC5)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102487370 (BIRC5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102487370 (BIRC5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tup01002]
    102487370 (BIRC5)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tup03036]
    102487370 (BIRC5)
Peptidases and inhibitors [BR:tup01002]
 Peptidase inhibitors
  Family I32: IAP family
   102487370 (BIRC5)
Chromosome and associated proteins [BR:tup03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     102487370 (BIRC5)
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102487370 (BIRC5)
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 102487370
NCBI-ProteinID: XP_006145771
UniProt: L9KZ73
LinkDB
Position
Un
AA seq 142 aa
MGAPSLPPAWQLYLKDHRVSTFKNWPFLEGCSCTPERMAEAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDDPIEEHKKHSSGCAFLSVKKRFEELTLGEFLKLDRERAKNKMAKEIGSK
HKEFEETAQKVHCAIEQLAALE
NT seq 429 nt   +upstreamnt  +downstreamnt
atgggcgccccgtccttgcccccggcctggcagctctacctcaaggaccaccgcgtctct
acgttcaagaactggcccttcttggagggctgctcctgcaccccggagcggatggccgaa
gccggcttcatccactgccccactgagaacgaacccgacctggcccagtgtttcttctgc
tttaaggagctggaaggctgggagccagatgacgaccccatagaggaacataaaaagcat
tcgtctggttgtgccttcctctctgtcaagaagcggtttgaggaattgaccctcggtgaa
tttttgaaactggacagagaacgagccaagaacaaaatggctaaagaaatcggcagcaag
cataaagagttcgaagagacggcccagaaggtgcactgtgccatcgagcagctggccgcc
ctcgagtga

DBGET integrated database retrieval system