KEGG   Tupaia chinensis (Chinese tree shrew): 102487728Help
Entry
102487728         CDS       T02978                                 

Gene name
HDAC6
Definition
(RefSeq) histone deacetylase 6
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup05034  Alcoholism
tup05165  Human papillomavirus infection
tup05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    102487728 (HDAC6)
  09164 Substance dependence
   05034 Alcoholism
    102487728 (HDAC6)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    102487728 (HDAC6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:tup01009]
    102487728 (HDAC6)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:tup03019]
    102487728 (HDAC6)
   04131 Membrane trafficking [BR:tup04131]
    102487728 (HDAC6)
   03036 Chromosome and associated proteins [BR:tup03036]
    102487728 (HDAC6)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102487728 (HDAC6)
Protein phosphatases and associated proteins [BR:tup01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102487728 (HDAC6)
Messenger RNA biogenesis [BR:tup03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     102487728 (HDAC6)
Membrane trafficking [BR:tup04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    102487728 (HDAC6)
Chromosome and associated proteins [BR:tup03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102487728 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 102487728
NCBI-ProteinID: XP_006171993
LinkDB All DBs
Position
Un
AA seq 1241 aa AA seqDB search
MTSTGQDATTTRQRRNRHSPQLPPHDSSVTSKRSVKKGTGPRTAHSLAELKKKGKMKKLS
QAASEEDLVMGLQGLDLNLEAKALAGTGLVLDEQLNEFHCLWDDSFPESPQRFHAIKEQL
IQEGLLDRCVSFPARFAEKEELMLVHSLEFIDLMETTQYMSEEELRVLADTYDSVYLHPN
SYTCACLASGSVLRLVDAVLGAEIRNGMAIVRPPGHHAQHSLMDGYCMFNHVAIAARYAQ
QKHSTQRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQ
GQGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAAT
PAGFAQLTHLLMGLAGGRLILSLEGGYNLRSLAKGVSASLHTLLGDPCPMLESPGAPCRS
AQISLSCALEALEPFWEILVRSVEPFKDDNMEDSTEDEDGPWEPPVLPMLTWPVPKARTG
LVYDQRMMSHHNLWDNHHPEMPQRISRIMSRLEELGLARRCLPLPARLATNAELLTCHSA
EYVSRLRATERMKSRELHREGANYDSIYICPSTFACAQLATGAVCRLVEAVLRGEVLNGA
AIVRPPGHHAEQDAACGFCFFNSVAVAARHAQALSGRALRILIVDWDVHHGNGTQHMFED
DPSVLYMSLHRYDHGTFFPMGHEGASNQIGRAAGIGFTVNVAWNGPRMGDADYLAAWHRL
VLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLANGRVLLILEGGY
NLTSISESMAACIHSLLGDSPPLLALQRPPLSGALASITETIQVHRRYWRSLRVTKAEDK
EELSISKSVTKKASQPANPGLTERMTPPQENILGAGMGKVTAALSAEESTPSQTKSETAV
VVLTVEQPSEAAVEGTIEGQTISEEAVGGATQGPTTSEEAPGGATEGQTTLEEVAGGATQ
DQTTSEEAEGVATQCQTTSEEAAKEATLGQTTSEKTGGKAMLHQTIAEAAEGEGMIDQTT
PEKTSRGATLDQTTSEEAVKGAELIQTPLDSCTEDQTTPTSPMQEAKPQISLSQLTGNNK
TLELDNKAQATTESQAPEEEGLLGEAAGGQAMDDSMLMQAFGNLVDTTQATFYAVMPRSW
CPHLVAVCPTPAAGLNVTQPCQDCGTCRENWVCLSCYQVYCARYVNAHMLRHYEDSGHPL
VLSYVDLSAWCYPCQAYVHHEALLDVKNIAYRDKFGEDMPH
NT seq 3726 nt NT seq  +upstreamnt  +downstreamnt
atgacctccaccggccaggatgccaccacaaccaggcagagaaggaataggcacagtccc
cagttaccccctcatgactccagcgtcacttcgaaacgaagtgttaagaagggcactgga
ccccgcaccgctcacagtctagcggaattaaagaagaaaggcaaaatgaagaagcttagc
caagcagcttctgaagaagacctagtcatggggctgcaagggctggatctgaaccttgag
gccaaggctctagctggcactggcttggtgttggacgagcagctaaatgaattccattgt
ctctgggatgacagctttcctgaaagccctcagcggttccatgccatcaaggagcaactg
atccaggagggcctcctggatcgctgtgtgtcctttccggcccggttcgccgaaaaagag
gagctgatgttggttcacagcctagagttcattgatctgatggaaacaacccagtatatg
agtgaggaggaactccgcgtcctagcagacacctatgactcagtttatctgcatccgaac
tcatatacctgtgcctgcctggcctcaggctccgtcctcaggctggtggatgcagtcttg
ggggctgagatccggaatggcatggccattgtcaggcctcctggacatcatgcccagcac
agtcttatggatgggtattgcatgttcaaccatgtggctatagctgcccgctacgcccag
cagaagcacagcactcagagggtccttatcgtggattgggatgtgcaccatggtcaagga
acacagttcaccttcgaccaggaccccagtgtcctctatttctccatccatcgctatgag
cagggtcggttctggcctcaccttaaagcctctaactggtccaccacaggttttggacaa
ggccagggatataccatcaatgtgccttggaaccaggtggggatgcgggatgctgactac
atcgctgctttcctgcacgtcttgctgccagtcgcccttgagttccagcctcagttggtc
ctggtggctgctggatttgatgccctccaaggagaccccaagggtgagatggccgccact
ccagcagggtttgcccagctcacccacctgctcatgggtctggcaggaggcaggctgatc
ctgtctctggagggtggctacaatctccgctcccttgccaaaggtgtcagtgcctcactc
cacacccttctgggagacccttgtcccatgctggagtcgcctggtgccccctgccggagt
gcccagatctcactctcctgtgctctggaagccctggagcctttctgggagatcctggtg
aggtcagtcgagcccttcaaggatgacaacatggaggacagcacggaggacgaggacggc
ccctgggagccccctgtgctcccgatgctgacctggccagtgcccaaggcccgcacaggg
ctggtctatgaccagcgtatgatgagccatcacaacttatgggacaaccaccaccctgag
atgcctcagcgcatctcccgaatcatgagccgcctagaggagctgggccttgccaggcgc
tgcctccccctgcccgcacgtcttgccactaatgctgagctgctcacctgccacagtgct
gagtacgtgagtcgtctccgggccacagagaggatgaaatcccgggagcttcaccgtgag
ggcgccaactatgactctatctacatctgtcccagcacctttgcctgtgcacaactggcc
actggcgcagtctgccgcttggtggaggctgtactcaggggagaagttttgaatggtgct
gccatcgtgcgccccccaggacaccatgctgagcaggatgcagcctgtggtttctgcttt
ttcaactctgtggctgtggcagctcgccatgcccaggccctcagtgggcgtgctctgcgg
atcctgattgtggactgggacgttcatcatggcaatgggactcagcacatgtttgaggat
gatcccagtgtgctgtatatgtccctgcaccgctatgatcacggtaccttcttccccatg
gggcatgagggtgctagcaaccagattggccgggccgctggcataggctttactgtcaat
gtggcctggaatgggccccgcatgggtgacgctgactacttggctgcctggcatcgtctg
gtgcttcccattgcctatgagtttaatccagaactggtgctggtctcagctggttttgat
gctgcacggggagacccactggggggctgccaagtgtcacctgagggctatgcccacctt
actcacctgctgatgggccttgccaatggccgtgttctccttatcctagagggtggttat
aacctgacatccatctcagagtctatggccgcctgcattcactctctccttggagactca
cctcccctgctggccttgcagcggcccccgctttcaggagccctggcctccatcactgag
accatccaagtccatcgcagatactggcgtagcttgcgggtcacaaaggcagaagacaag
gaggaactctccatttctaagtctgttaccaagaaggcatcccaaccagccaatcctggg
ttgactgagaggatgaccccgccacaagagaacatcctgggagcaggcatggggaaggtc
accgcagcattatctgcagaagagtccactccaagccagactaagtcagaaacagctgtg
gtggtgttgactgtggagcagccctcagaggcagctgtggagggaaccatagagggccag
accatctcagaggaggctgtggggggagccacacagggcccaaccacctcagaggaggca
ccagggggagcaaccgagggccagaccaccttagaggaggtggcagggggagccacacag
gaccagaccacctcagaggaggcagagggggtagccacacagtgccagaccacttcggag
gaggcagcaaaggaagccactctgggccagaccacctctgagaagactggagggaaagcc
atgctgcaccagaccatcgcagaggcagccgaaggggaaggcatgatagaccagaccact
ccagaaaagacttcaaggggagctacacttgaccagaccacctcagaggaggctgtgaag
ggagcagaactgatccaaactcctctagactcatgcacagaagaccagaccacccctacc
tcacctatgcaagaagccaaaccccaaatatctctcagtcagctgactgggaataacaaa
accttggaactagacaacaaagcacaggcaaccacagaatctcaggccccagaagaggag
ggcctcctaggagaggcagctggaggtcaggccatggatgattctatgctgatgcaggca
tttgggaaccttgttgacactacacaggccacattttatgctgtaatgccacggtcctgg
tgtccccatttggtggcagtatgccccacacctgcagcaggcttaaatgtgacccagcct
tgccaggactgtggaacgtgcagggagaattgggtgtgtctgtcctgctatcaggtctac
tgcgctcgttatgtaaatgcccacatgctccgacactatgaagactctggacacccattg
gtcctcagctacgttgacctgtctgcttggtgttacccctgccaggcctatgtacaccat
gaggctctcctagacgtgaagaacatcgcctaccgggacaagtttggggaggatatgcct
cattaa

DBGET integrated database retrieval system