KEGG   Tupaia chinensis (Chinese tree shrew): 102488021Help
Entry
102488021         CDS       T02978                                 

Gene name
HDAC10
Definition
(RefSeq) histone deacetylase 10
  KO
K18671  histone deacetylase 10 [EC:3.5.1.98]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup05034  Alcoholism
tup05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    102488021 (HDAC10)
  09165 Substance dependence
   05034 Alcoholism
    102488021 (HDAC10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tup03036]
    102488021 (HDAC10)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102488021 (HDAC10)
Chromosome and associated proteins [BR:tup03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102488021 (HDAC10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 102488021
NCBI-ProteinID: XP_006157644
LinkDB All DBs
Position
Un
AA seq 673 aa AA seqDB search
MGTALVYHEDMTAPRLLWDDPECQIECPERLTAALDLLRQCGLEQRCTRLSTREASEAEL
GLVHSLEYVALVRGTQALGEAELQALSGQYDAVYFHPSTYHCARLAAGAALQLVDAVLAG
TVRNGLALVRPPGHHSQRAAASGFCVFNNVAIAAQHAKQKHGLHRILIVDWDIHHGQGIQ
YIFEDDPSVLYFSWHRYEHGRFWPFLRESDADVVGRGQGRGFTVNLPWNQVGMGNAEYLA
AFLHVLLPLAFEFGPELVLVAAGFDSAIGDPEGQMQATPECFAHLTHLLQVLAGGRVCAV
LEGGYHLESLAQSVCMTVQALLGDPAPPLLRPMVPCQSALVSIQRVRAAQAPHWTSLQEN
DSAPLLGPRTRSPDERPPPQLPGGPVCEAAVAVPSCPLGQLCLCPIPPVRTAAALTTPVA
SLILPPGVLLQEGSASMEKTEAWARLHRSLAQDEALMALGKLLNLLDGILDGQVGSGVVA
IPAPAATATLDVVIQQSLSLRTERVLCVVLGQLDRPLDLADDGRTLWLHIRGQEASALSM
FQVSMPLPGTTGGFLSCILGLVLPLAYGFQPDMALMVLGPAHGLEVPQAALLATLLRGPA
GGRVLALVEEGSAVQLAGVLASVLQGQAPPSLGPFVSASAEDSQALKYLRRQLGARWGML
QVEAEADWGCLPP
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgggcactgcactcgtgtaccacgaggatatgacagccccccggctgctctgggacgac
cctgagtgccagatcgagtgcccggagcgcctaaccgcagccctggacctcctgcggcag
tgcggcctggagcagaggtgcacgcggctatctacccgggaggcttcggaggcggagctg
ggcctggtacacagcctggagtacgtggccctggttcggggaacccaggccctgggcgag
gcagagctccaggctctgtctggacagtacgatgccgtctacttccacccgagcacctac
cactgcgctcggctggctgcgggggctgcactgcagctggtggacgccgtgctggctgga
actgtgcgcaacgggcttgccctggtgaggcctcctgggcaccacagccagcgggcagca
gccagtgggttctgcgtgttcaacaatgtggccattgcagctcaacacgccaagcagaag
catgggctgcacaggatcctcattgtagactgggacattcaccatggccagggcatccaa
tacatcttcgaggatgaccccagcgtcctttacttctcctggcatcgctatgaacacggg
cgcttctggcccttcctgcgagagtcggatgcagacgtggtggggcgggggcagggccgt
ggcttcactgtcaacctgccctggaaccaggtagggatgggcaatgctgagtacttggct
gcatttctgcacgtgctcctcccactggccttcgagtttggccctgagttggtgctggtt
gcggcagggttcgactcagccatcggagaccctgaggggcagatgcaggccacgccagaa
tgctttgcccacctcacacacctgctgcaggtgctggctggcggccgggtctgtgccgtg
ctggagggcggctaccacctggagtcgctggcacagtcggtgtgcatgacggtgcaggca
ctgctgggcgaccctgccccacccctgctgcggcccatggtgccctgtcagagcgccctg
gtatctatccagcgtgtccgagcagcccaggcccctcactggacaagcctccaggagaac
gactcagccccattgctgggtccccgcactcgttccccagatgagaggcccccaccacag
ctgcctggaggtcctgtgtgtgaggcagcggtagcagtgccaagctgtcccctgggccag
ctgtgcctctgccccataccccctgttcgcacggctgctgccctgaccacaccagttgcc
agcctcatcctgcctcctggtgtcctccttcaggaggggtcagcctcgatggagaagaca
gaagcctgggccaggctacacaggtccctggcccaggatgaggccctcatggcacttggg
aagctcctgaacctcttagatgggatcctggatgggcaggtgggcagcggtgttgtagcc
atcccagcccctgctgcaacagccaccctggacgtggttattcagcaaagcctatccctc
agaaccgagagggtgctctgtgtggtcctaggacagctggaccggcccctggaccttgct
gatgatgggaggaccctgtggctgcacatcaggggccaggaggcttctgctttgtccatg
ttccaggtctccatgccactgccagggacgactggtgggttcctgagctgcatcctgggt
ctggtgctgcccctagcctatggctttcagcctgacatggcgctgatggtgctagggcct
gcccacggcctggaggtcccccaggctgctctcctggccaccctgctccgagggccggca
gggggccgagtgctggccctggtggaggagggatccgcagttcagctcgcaggggtcctg
gccagcgtgctgcagggacaggccccgcccagcctgggccctttcgtctcggcttccgca
gaggacagccaggccctgaagtacctgaggcggcagctgggggcgcggtgggggatgctg
caggtggaggctgaggcggactggggctgcctgcctccgtag

DBGET integrated database retrieval system