KEGG   Tupaia chinensis (Chinese tree shrew): 102488187
Entry
102488187         CDS       T02978                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup04010  MAPK signaling pathway
tup04014  Ras signaling pathway
tup04015  Rap1 signaling pathway
tup04020  Calcium signaling pathway
tup04072  Phospholipase D signaling pathway
tup04144  Endocytosis
tup04151  PI3K-Akt signaling pathway
tup04510  Focal adhesion
tup04540  Gap junction
tup04630  JAK-STAT signaling pathway
tup04810  Regulation of actin cytoskeleton
tup05163  Human cytomegalovirus infection
tup05200  Pathways in cancer
tup05206  MicroRNAs in cancer
tup05214  Glioma
tup05215  Prostate cancer
tup05218  Melanoma
tup05230  Central carbon metabolism in cancer
tup05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102488187 (PDGFRA)
   04014 Ras signaling pathway
    102488187 (PDGFRA)
   04015 Rap1 signaling pathway
    102488187 (PDGFRA)
   04630 JAK-STAT signaling pathway
    102488187 (PDGFRA)
   04020 Calcium signaling pathway
    102488187 (PDGFRA)
   04072 Phospholipase D signaling pathway
    102488187 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    102488187 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102488187 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102488187 (PDGFRA)
   04540 Gap junction
    102488187 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102488187 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102488187 (PDGFRA)
   05206 MicroRNAs in cancer
    102488187 (PDGFRA)
   05230 Central carbon metabolism in cancer
    102488187 (PDGFRA)
   05231 Choline metabolism in cancer
    102488187 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    102488187 (PDGFRA)
   05218 Melanoma
    102488187 (PDGFRA)
   05215 Prostate cancer
    102488187 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102488187 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102488187 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tup01001]
    102488187 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:tup04090]
    102488187 (PDGFRA)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102488187 (PDGFRA)
Protein kinases [BR:tup01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   102488187 (PDGFRA)
CD molecules [BR:tup04090]
 Proteins
  102488187 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 102488187
NCBI-ProteinID: XP_006143745
UniProt: L9L577
LinkDB
Position
Un
AA seq 1089 aa
MGTSHPAFLVLGCLLTGPGLISCQLALPSILPNEHEKVVQLNSSFSLTCFGESEVSWRYP
VYEEESPDVDIRNEENNSGLFVSVLEVGHALAAHTGLYTCYYNHTQTDENELEGRDIYIH
VPDPDVAFVPLGMTDYFVVVEEDESVIIPCRTTDPDTVVTLRNSDGVVPASYDSKQGFNG
SFTDGPYTCEATVEGKTFQTIPFNVYTFQATAKLDLEMEVLKTVYKSGETIVLTCAVFNN
EVVDLQWIYPGKVKGRGSILLEEIKVPFIKLLYTLRIPEATVKDSGDYECAARHATRDVK
EMKKVTIAVHEKGFIEIKPTFSQLEAVNLHEVKHFVVDVWAYPSPRISWLKDNLTLIENL
TEITTDVEKIQEIRYQSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFQLLTQVPASILDV
VDDHHGSTGGQTVTCMAEGTPLPEIEWMVCKDIKKCNNETSWTVLANNASNVLMELHPQD
RSTVEGRVTFLKVEETVAVRCLAKNPLGAENRELKLVAPALRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLHPADESTRSY
VILSFENNGDYVDMRQAYTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKPALDAEVKD
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEMVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDLDHTYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDLDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDGMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccatccagcattcctggtcctgggctgcctcctcacagggcctggcctc
atctcctgccagctcgcgctgccctccatccttcccaacgaacacgagaaggtcgtgcag
ctgaattcgtccttttctctgacgtgctttggggagagcgaagtgagctggcggtacccc
gtgtatgaagaagagagccccgacgtggacatcagaaacgaggaaaacaacagcggcctg
ttcgtgagcgtgctggaggtgggccatgccttggcagcccacacggggctgtacacctgc
tactacaaccacacgcagacggacgagaatgagctggaaggccgggacatctacatccac
gtgccagaccctgatgtagccttcgtccccctgggaatgaccgattatttcgttgtcgtg
gaggaggacgagtctgtcatcattccttgccgcacgacagaccccgacactgtcgtaacc
ctgcgcaacagtgacggcgtggtccctgcctcctatgacagcaagcagggctttaatggc
agcttcacagacgggccctacacctgcgaggccacggtcgaagggaagacgttccagacc
atcccgtttaacgtttatacctttcaagcaacagcaaaactggatctagaaatggaagtt
cttaaaactgtgtacaagtcaggcgaaacgattgtcctcacctgcgctgtctttaacaac
gaggtggttgacctgcagtggatttaccccgggaaagtgaaaggcagaggcagcattctg
ctggaggaaatcaaagtcccattcatcaaattgctgtacacactgaggatccccgaggcc
accgtgaaagacagtggcgactacgagtgtgctgcccgacacgcgaccagggacgtcaaa
gagatgaagaaagtcaccatcgctgttcacgagaaaggcttcattgaaatcaaacccacc
ttcagccagctggaagctgtcaacctgcacgaggtcaagcacttcgtggtggacgtgtgg
gcctacccctctcccaggatatcctggctgaaggacaacctgactctgattgaaaatctc
accgagatcaccactgacgtggagaagatccaggaaataaggtatcaaagcaaactcaag
ctgatccgtgcaaaggaggaagacagtgggcattacaccatcgtggtgcagaatgaagac
gacgtgaagagctacactttccaactcctgacccaggttcccgcctccattctggacgtg
gttgacgaccaccacggctctaccgggggacagacggtgacgtgcatggccgaagggact
cctctccctgaaatcgagtggatggtttgcaaggatattaagaaatgtaataacgaaact
tcctggacagttttggccaacaatgcctccaacgtcctcatggagctccacccccaagac
aggagtaccgtggagggccgagtgacgttcctcaaagtggaggagaccgttgcagtgcgg
tgcctggccaagaaccctcttggagctgagaaccgagagctaaagctggtggcgcctgcc
ctgcgttctgagctcacggtggcggccgcggtcctggtgctgttggtgattgtgatcatc
tccctcattgtcctggttgtcatttggaaacagaaaccgaggtatgagattcgctggcgg
gtcattgagtcaatcagccccgatggacatgaatatatttatgtggacccgatgcagctg
ccgtatgactccaggtgggagttcccgagagacggattagtgcttggtcgggtcttggga
tctggcgcgtttgggaaagtggtggaaggaacagcctatgggctgagccggtcacagcct
gtcatgaaagttgcggtgaagatgctgaaacccacagccagatccagtgaaaagcaagcg
ctcatgtctgaactgaagataatgacgcacctggggccacacttaaacattgtgaacctg
ctgggagcctgtaccaagtcaggccccatttacatcatcaccgagtactgcttctacgga
gatctagtcaactacttgcataagaacagggacagcttcctcagccgccacccggagaag
ccaaagaaagagctggacatttttggactgcaccctgctgacgagagcacacggagttac
gttatcttatctttcgaaaacaacggtgactacgtggacatgagacaagcgtatacgacg
cagtacgtccccatgctggagaggaaagaggtttctaagtattcggacatccagaggtct
ctgtacgatcgcccggcctcctataagaagaaacccgcattagatgctgaagtcaaagac
ctgctgtcggatgataactcggaaggccttactttgttggatttgttgagcttcacctat
caagtggcccgaggcatggagtttttggcgtcaaaaaattgtgtccaccgggacctggct
gctcgcaatgttctcctggctcaaggaaaaattgtgaagatctgtgactttggcctggcc
agggacatcatgcatgattccaactacgtgtcgaaaggcagcaccttcctgcccgtgaag
tggatggctccggagagcatcttcgacaacctctacacaacgctgagcgacgtctggtcc
tacggcatcctgctctgggagatcttctccctcggtggcacgccctaccctggcatgatg
gtggattctactttctacaataagatcaagagtgggtaccggatggccaagcccgaccat
gccaccagtgaagtctacgagatcatggtcaagtgctggaacagtgagccagagaagaga
ccctccttctaccacctgagcgagatggtggagaatctgctgcccggacagtataaaaag
agttatgaaaaaattcacctggacttcctgaagagcgaccatccggccgtggcgcgcatg
cgcgtggacttggaccacacgtacatcggcgtcacctacaaaaacgaggaggacaagctg
aaggactgggaggggggcctggacgagcagaggctgagcgcagacagcggctacatcatc
cctctgccggacctcgacccggtgcccgaggaggaagacctgggcaagaggaatcgacac
agctcgcagacgtctgaagagagtgctattgagacaggctccagcagctcgaccttcatc
aagagggaggacgagaccattgaggacattgacgggatggacgacattggcatagactcc
tcagacctggtagaggacagcttcctgtaa

DBGET integrated database retrieval system