KEGG   Tupaia chinensis (Chinese tree shrew): 102488209
Entry
102488209         CDS       T02978                                 

Gene name
CHRM3
Definition
(RefSeq) cholinergic receptor muscarinic 3
  KO
K04131  muscarinic acetylcholine receptor M3
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04020  Calcium signaling pathway
tup04080  Neuroactive ligand-receptor interaction
tup04725  Cholinergic synapse
tup04742  Taste transduction
tup04810  Regulation of actin cytoskeleton
tup04911  Insulin secretion
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102488209 (CHRM3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102488209 (CHRM3)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102488209 (CHRM3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102488209 (CHRM3)
  09154 Digestive system
   04970 Salivary secretion
    102488209 (CHRM3)
   04971 Gastric acid secretion
    102488209 (CHRM3)
   04972 Pancreatic secretion
    102488209 (CHRM3)
  09156 Nervous system
   04725 Cholinergic synapse
    102488209 (CHRM3)
  09157 Sensory system
   04742 Taste transduction
    102488209 (CHRM3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102488209 (CHRM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:tup04030]
    102488209 (CHRM3)
G protein-coupled receptors [BR:tup04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    102488209 (CHRM3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 102488209
NCBI-ProteinID: XP_006146010
UniProt: L9L3Y3
LinkDB
Position
Un
AA seq 590 aa
MTLHSNSTTSPLFLNISSSWIHSPSDAGLPPGTLTHFGSSNVSQAVGNFSSPNGTTSDPL
GGHTVGQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVI
SMNLFTTYIIMNRWALGNLACDLWLSVDYVASNASVMNLLVISFDRYFSITRPLTYRAKR
TTKRAGVMIGLAWVISFILWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF
YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVHPTGSSRSCSSYELQQQSM
THTTRRKYGRCHFWFTTKRWKPKAEQMDQDHSSSDSWNNNEAAASLENSASSDEEDIGSE
TRAIYSIVLKLPGHSTILNSTRSPSSDNLQVAEEELRMEDLERKANKLQAQKSMDDGSNF
QRSFSKLPIQLGSAVDTTKTSDVNSSVGKTTATLPLSFKEATLAKRFALKTRSQITKRKR
MSLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVN
PVCYALCNKTFRTTFKMLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQPS
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgacgttgcacagtaacagtacaacctcgcctttgtttctgaacatcagctcctcctgg
atacacagtccctctgatgcagggctccctccaggaacactcactcattttggcagctcc
aatgtttctcaagctgtggggaatttctcctctccaaatggtaccaccagtgaccctctg
ggaggtcacactgttgggcaggtggtcttcattgcttttttaacaggcttcctggccttg
gtgaccatcattggcaacatcctagtgattgtggcattcaaggtcaacaaacagctgaag
acagtcaacaactacttcctcctgagtcttgcctgtgctgacctgattattggggtaatt
tcaatgaatctgttcaccacctacatcattatgaatcgatgggctcttgggaacttggcc
tgtgacctctggctctctgtggactatgtggccagcaatgcctctgtcatgaatcttctg
gtcatcagcttcgacagatacttttccatcacaaggccactcacataccgagccaaacga
acaaccaaaagagcaggtgtgatgattggtctggcttgggtcatctcttttattctgtgg
gcccctgccatcttgttctggcaatactttgttgggaaaagaaccgtgccgcctggggag
tgtttcatccagttcctcagtgagcccaccattaccttcggcacagctattgctgccttt
tacatgcccgtcaccattatgactattttatattggaggatctataaagaaactgaaaag
cgtaccaaagagcttgctgggctgcaagcctctgggacagaagcagaagcagaaaacttt
gtccaccccacaggcagttcacgaagctgcagcagctatgagcttcaacagcaaagcatg
acacataccaccaggaggaagtatggccgctgccacttctggttcacaaccaagcgctgg
aagcccaaagctgaacaaatggaccaagaccatagcagcagtgacagctggaacaacaac
gaagctgctgcctctctggaaaactctgcctcctctgatgaggaggacattggctctgag
acgagagccatctactccattgtgctcaagctcccaggccacagcaccatcctcaactcc
accagatcaccctcatcagacaacttgcaggtagctgaggaggagctgaggatggaggac
ttggagaggaaagccaacaagctgcaggcccagaagagtatggacgatgggagcaatttc
cagagaagcttttccaagcttcccatccagttagggtcagctgtggacacaaccaagact
tctgatgtcaattcatcagtgggtaagaccacggccactctacctctgtccttcaaggaa
gccactctggccaagagatttgctctgaagaccagaagtcagatcactaagcggaagaga
atgtctctcatcaaggagaagaaagccgcccagaccctcagtgcgatcctgctcgccttc
atcatcacctggacaccctacaatatcatggttctggtgaacaccttctgtgacagctgc
atccctaaaacttattggaatctgggctattggctgtgctacatcaacagcaccgtcaac
cccgtgtgctatgcgctgtgcaacaagactttcagaaccaccttcaagatgctgctgctc
tgccagtgtgacaaaaggaagcggcgcaaacagcagtaccagcagagacagtcggtcatc
ttccacaagcgtgtgcccgagcagccctcatag

DBGET integrated database retrieval system