KEGG   Tupaia chinensis (Chinese tree shrew): 102488737
Entry
102488737         CDS       T02978                                 

Gene name
CACNA1E
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04010  MAPK signaling pathway
tup04020  Calcium signaling pathway
tup04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102488737 (CACNA1E)
   04020 Calcium signaling pathway
    102488737 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102488737 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tup04040]
    102488737 (CACNA1E)
Ion channels [BR:tup04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102488737 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 102488737
NCBI-ProteinID: XP_006142380
LinkDB
Position
Un
AA seq 2312 aa
MARFGEAVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAYKQSKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECKDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNSGTSALEVLRRATIKRSRT
EAMTRDSSDEHCVDISSVGTPLARASIKSTKVDGASYFRHKERLLRISIRHMVKSQVFYW
IVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQ
RTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLNAHPSLYRRPRPIEGLALGL
GLEKCEEERISRGGSLKGDSGDLSSVLDNQRSPLALGKREPPWLARPCHGNCDPTQQEAG
GGETVVTFEDRARHRQSQRRSRHRRVRTEGKESASASRSRSASQERSLDEGVLPEGEKDH
DPRGSHGGKEPTIQEERAQDLRRTNSLMVPRGSGLAGALDEADTPLVLPHPELEVGKDAV
LTEQEPEGSSEQALLGDVPLDVGRAISQSEPDLSCITATTDKATTESTSVAVAIPDVGPL
VDSTVVHISNKTDGEASPLKEAEIKEDEEEVEKKKKKEKRETGKAMVPHSSMFIFSTTNP
IRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTFEM
VIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLRVLR
VLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDS
SKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHS
VDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEK
NERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYS
APCTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEIILTD
SKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIY
AIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCEPD
TTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHL
DEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDM
TVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPKAS
DLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKALPYL
QQDPVSGLSGRSGYPSMSPLSPQEIFQLACMDPNDDGQFQEQQSLEPEVSELKSVQSSSH
GIYLPSETQEHAGSGRASSMPRLTVDPQVVTDPSSMRRSFSTIRDKRSNSSWLEEFSMER
SSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVSRCN
SEERGTQADWESPERRQSRSPSEGRSQTPNRQGTGSLSESSIPSISDTSTPRRSRRQLPP
VPPKPRPLLSYSSLIRHAGSISPPADGSEGGSPLASQALESNSACLTESSNSPHPQQGQH
SSPQRYISEPYLALHEDSHASDCGEEETLTFEAAVAASRARSNTIGSAPPLRHSWQMPNG
HYRRRRRGGPGPGMMCGAVSDLLSDTEEDDKC
NT seq 6939 nt   +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcggcaggccggggtcgggcgatggagactcggac
cagagcaggaatcggcaaggaacccccgtgccggcctcggggccggcggccgcctacaag
cagtcgaaagcgcagagggcgcggactatggctttgtacaaccccatccccgtccggcag
aactgtttcaccgtcaacagatccctgttcatcttcggagaagataacattgtcaggaaa
tacgccaagaagctcatcgattggccgccgtttgagtacatgatcctggccaccatcatt
gccaactgcatcgtcttagccctggagcaacaccttcccgaggatgacaagaccccgatg
tcccgaagactggaaaagacagaaccgtattttattgggatcttttgctttgaagctggg
atcaaaattgtggccctggggttcatcttccataagggttcatacctccgcaatggctgg
aatgtcatggacttcatcgtggtcctcagtggcatcctggccactgcgggaacccacttc
aacactcacgtggacctgaggaccctccgagcagtgcgtgtcctgaggcccttgaagctc
gtgtcagggatacctagcctgcagattgtgttgaagtccatcatgaaggccatggtgcct
cttctacagatcggcctcctgctcttctttgccatcctgatgtttgctatcattggcttg
gagttctacagtgggaagttacatcgagcatgcttcatgaacaattcaggtattctagaa
ggatttgatccccctcacccctgtggtgtgcagggctgcccagctggctatgaatgcaag
gactggatcggccccaatgatgggatcacccagtttgacaatatcctcttcgccgtgctg
actgttttccagtgcatcaccatggaagggtggaccaccgtgctgtacaataccaatgat
gccttaggagccacctggaactggctgtacttcattcctctcatcatcattggatccttc
tttgttctcaacctagtcctgggcgtgctttctggggaatttgccaaagagagagagaga
gtggagaataggagagctttcatgaagctgcggcgccagcagcagatcgagcgtgaactg
aacggctaccgtgcctggatagacaaagcagaggaagtcatgcttgcagaagaaaataaa
aactctggaacatccgccttagaagtgcttcgaagggcaaccatcaaaaggagccggacg
gaggccatgacccgagactccagcgatgagcactgcgttgatatctcttctgtgggtaca
cctcttgcccgagcaagtatcaaaagcacaaaggtagacggggcttcctacttccggcac
aaggaaagacttctgcgcatctccatccgccacatggtcaaatcccaggtgttttactgg
atcgtgctgagcctcgtggctctcaacactgcctgtgtggccatcgtccatcacaaccag
ccccagtggctcacccacctcctgtactatgcagaattcttgtttctgggacttttcctt
ttggagatgtctctgaagatgtatggcatggggcctcgcctttattttcattcttcgttc
aactgctttgattttggggtcacagtgggcagtatctttgaagtggtctgggcaatcttc
agacctggtacatcttttggaatcagtgtcttacgagctctccggcttctaagaatattt
aaaataaccaagtattgggcatccctgaggaatttggtggtctccttgatgagttccatg
aagtctatcatcagtttactcttcctcctcttcctgttcattgtcgtctttgctctccta
ggaatgcagctgtttggaggcaggtttaactttaatgatgggaccccttcagcaaacttt
gataccttccctgccgccatcatgactgtgttccagatcctgacaggggaggactggaat
gaggtgatgtacaatggcatccgttcccagggtggggtcagctcaggcatgtggtcagcc
atctacttcatcgtgctcaccttgtttggaaactacacactgctgaatgtgttcttggcc
atcgctgtggacaatctggccaatgctcaggagctgaccaaggatgagcaagaggaagag
gaagccttcaaccagaaacatgcactacagaaggccaaggaggtcagcccgatgtccgca
cccaacatgccttctatcgaaagagacagaaggagaagacaccacatgtcgatgtgggag
ccacgcagcagccacctgcgggagcggcggcggcggcaccacatgtcagtgtgggagcag
aggaccagccagctgaggaggcacatgcagatgtccagccaggaggccctcaacaaggag
gaggccccaccaatgaaccccctcaacccgctcaatcccctgagtcctctcaacccgctc
aatgcccaccccagcctctaccggagacccaggcccattgaaggcctggctctgggcctg
ggcctggagaagtgtgaggaggagcgcatcagccgtgggggatccctcaagggggacagc
ggggacctgtccagtgtcctggacaatcagaggagccccttggccctgggcaaacgggag
ccaccgtggctggcccgtccctgtcatgggaactgcgatccaacccagcaggaggcaggt
gggggagagactgtggtgaccttcgaggatcgggccagacacaggcagagccagcgacgc
agccggcaccgccgagtcaggacagaaggcaaggagtcagcctctgcctctcggagcagg
tctgccagccaagagcggagtctggatgaaggagtcctccctgaaggggagaaggaccat
gatcccaggggcagccatgggggcaaggaaccaacgatccaagaagaaagagcccaggat
ttaaggaggaccaacagtctgatggtgccccgaggctctgggctggcaggagccctcgat
gaggctgacacacccctcgtccttccccatcctgagctggaagtgggcaaggatgcagtg
ctgactgagcaagagcccgagggcagcagcgagcaagccctgctgggggacgtgccgctg
gacgtgggtcgggccatcagccagagcgagcctgacctctcctgcatcacggccaccaca
gacaaggccaccaccgagagcaccagcgttgctgtcgccatccctgacgtgggccccttg
gtggactcgacggtggtgcacattagcaacaagactgatggagaagccagtcccttgaag
gaggcagagattaaagaggatgaggaggaagtggagaaaaagaagaaaaaggagaagcgt
gagacaggcaaagccatggtgccccatagctccatgttcatcttcagcaccaccaacccg
attcggagggcctgccactacatcgtgaacctgcgctactttgagatgtgcatcctccta
gtgatcgcagccagcagcatcgccctggccgcagaggaccctgtcctgaccaattcggag
cgcaacaaagtgctgaggtatttcgactatgttttcaccggcgtgttcacctttgagatg
gttataaagatgatagaccagggcttgatcctgcaggatgggtcctacttccgagaccta
tggaacatcctggactttgtggtggtggttggtgcgttggtggcctttgctcttgcgaat
gctttgggaactaacaagggacgggacatcaagaccatcaagtctctgcgggtgctccga
gttctgaggccactgaaaactatcaagcgcttgcccaagctcaaggctgtcttcgactgt
gtggtgacctccttaaagaatgttttcaacatactcattgtctacaagctcttcatgttc
atctttgccgtcatcgcagtgcagctcttcaagggaaagttcttttactgcacggacagt
tccaaggacacggaaaaggagtgcataggcaactatgtagatcatgagaaaaacaagatg
gaagtgaagggccgggaatggaagcgccatgaattccactatgacaacatcatctgggct
ttgttgaccctcttcactgtctccacaggagaaggatggcctcaggttttacagcattct
gtagatgtgacagaggaagaccgaggtcccagccgcagcaaccgcatggaaatgtccatt
ttttatgtggtctactttgtggttttccccttcttctttgtcaatatctttgtggctctc
atcatcatcaccttccaggagcagggggacaagatgatggaggaatgcagcctggagaag
aatgagagggcctgcattgacttcgccatcagcgccaaacctctcacccgctacatgcca
caaaataggcacaccttccagtaccgggtgtggcatttcgtggtgtccccatcctttgag
tataccatcatggctatgatcgccctgaacactgttgtgctgatgatgaagtactattct
gctccttgtacctacgaactggccctaaagtacctgaatattgccttcaccatggtgttt
tccctggaatgtgtcctaaagatcatcgcttttggtttcttgaactatttccgagacacc
tggaatatctttgacttcatcaccgtgattggcagtatcacagaaattatcctgacagac
agcaagctggtgaacaccagcggcttcaatatgagctttctgaagctcttccgtgccgcc
cgcctcataaagcttctgcgtcagggctacaccatccgtattttactttggaccttcgtg
cagtccttcaaggccctcccctacgtctgccttttgattgccatgcttttcttcatttat
gctatcattgggatgcaggtgtttggaaacataaaattagatgaggagagtcacatcaac
cggcacaacaacttccggagtttctttgggtccctcatgctactcttcaggagtgccacg
ggtgaggcctggcaggagattatgctgtcgtgccttggagagaagggctgtgagcccgac
accacagcaccttcagggcagaacgagaatgagcgctgcggcaccgacctggcctacgtg
tacttcgtttccttcatcttcttctgctccttcttgatgctcaacctgttcgtcgctgtc
atcatggacaacttcgagtacctgacacgggactcttccatcctgggacctcaccatttg
gatgagtttgttcgtgtctgggcagagtacgacagagcagcatgtggccgtatccattac
actgagatgtatgaaatgctgactctcatgtcaccaccgctaggcctcggcaagagatgt
ccctccaaagtggcctataagaggttggtcctgatgaatatgccagtagctgaggacatg
actgtccatttcacctccacactcatggctctgatccggacagctctggacattaaaatt
gccaaaggtggtgcagacaggcagcagctagattcggaactgcagaaagagaccctggcc
atctggcctcacctgtcccagaagatgctggatctgcttgtgcccatgcccaaagcctca
gacctgactgtgggcaaaatctatgcagcaatgatgatcatggactactacaaacagagc
aaggtgaagaagcagaggcagcagctggaggaacagaaaaatgcacccatgttccagcgc
atggagccctcatctctgcctcaggagatcattgctaatgccaaagccctgccttatctc
cagcaggatcccgtctcaggcctgagtggccggagcggatacccttcgatgagcccactc
tccccccaggaaatattccagttggcttgtatggacccaaatgatgatggacagttccag
gagcagcaatctctggagccagaggttagtgaattaaaaagcgtgcagtcctctagccat
ggcatctaccttccttcggaaacccaggagcatgcgggatctgggagggcatcctctatg
ccacgtctgactgtggatccccaggtggtgacagaccctagctccatgagacgttcattt
tccaccattcgcgataagcgctcaaattcctcatggttggaggaattctccatggagcgg
agcagtgaaaacacctacaagtcacgtcgccggagttaccactcctccctgcggctgtca
gcccatcgcctgaactctgactcaggtcacaagtctgacacccatcgctcagggggcagg
gagcgggggcgatcaaaagagcgaaagcatcttctctctcctgatgtttcccgctgcaat
tcagaggagcgggggacccaggccgactgggagtccccagagcgccggcagtccaggtca
cccagtgagggcaggtcacagactcccaacagacagggcacggggtccctgagtgagagc
tccatcccctccatctctgacaccagcaccccaagacgaagtcggcggcagctcccacct
gtccctccgaagcctcgacccctcctgtcctacagttccctgattcgacatgctggcagc
atctctccacctgcagatggaagtgaggggggctcccccttagcctcccaagccctggag
agcaacagcgcttgcctgaccgagtcttccaactccccgcacccccagcagggccagcac
tcatccccacagcgctacatctctgagccctacctagccctgcacgaagactcccacgcc
tcggactgtggcgaggaggagacgctcaccttcgaagcagccgtggctgccagccgggcc
cgctccaacaccatcggctcagccccgcccctgcggcacagctggcagatgcccaatggg
cactaccggcggcggaggcgtggggggcctgggccaggcatgatgtgtggggctgtcagc
gacctccttagtgacacggaagaagatgacaagtgctag

DBGET integrated database retrieval system