KEGG   Tupaia chinensis (Chinese tree shrew): 102489026
Entry
102489026         CDS       T02978                                 

Gene name
MLH1
Definition
(RefSeq) mutL homolog 1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01524  Platinum drug resistance
tup03430  Mismatch repair
tup03460  Fanconi anemia pathway
tup05200  Pathways in cancer
tup05210  Colorectal cancer
tup05213  Endometrial cancer
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    102489026 (MLH1)
   03460 Fanconi anemia pathway
    102489026 (MLH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102489026 (MLH1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102489026 (MLH1)
   05226 Gastric cancer
    102489026 (MLH1)
   05213 Endometrial cancer
    102489026 (MLH1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102489026 (MLH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tup03400]
    102489026 (MLH1)
DNA repair and recombination proteins [BR:tup03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     102489026 (MLH1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 102489026
NCBI-ProteinID: XP_006161131
LinkDB
Position
Un
AA seq 759 aa
MSLVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVVVKEGGLKLIQ
IQDNGTGIRKEDMDIVCERFTTSKLQTFEDLANISTYGFRGEALASISHVAHVTITTKTA
DGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNITTRRKALKNPSEEYGKILEVV
GRYAIHNSGISFSVKKQGETVADVRTLPSATTVDNIRSIFGNAVSRELIEVGCEDKTLAF
KMSGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEESILERVQQHIESQLLGSNSSRLYFTQTLLPGLAGPSGEVI
KSSAGPTPSSASGSGDKVYAHQMVRTDSREQKLDAFLQPPSKPPSRQPQTSVPEGRSETM
ARQQDEEMLELPAPKCLNSQMAARSQDLEEDTATATPETAEERGPASSPANPRKRHREES
DVEMVEDDSQKELTAACTPRRRIINLTSVLTLQEEINERGHETLREMLHNHSFVGCVNPQ
WALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGW
TEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLTGLPLLIDNYVPPLEGLPIFI
LRLATEVNWDEEKECFESLSKECAMFYSVRKQYISEESTLSAQQNEVPGSAPNSWKWAVE
HIVYKAFRSHLLPPKQFTEDGSILQLANLPDLYKVFERC
NT seq 2280 nt   +upstreamnt  +downstreamnt
atgtcgctcgtggcaggggtcatacggcggctggacgagacagtggtgaaccgcatcgcg
gcgggggaagtaatccagcggcctgctaatgctatcaaagagatgattgagaactgttta
gatgcaaaatccacaagtatccaagtggttgttaaagagggaggcttgaaattgattcag
atccaagacaatggcacaggaatcaggaaagaagatatggatattgtgtgtgagaggttc
actaccagtaaactgcagacctttgaggatttagccaacatttctacctacggttttcga
ggtgaggctttggccagtataagccacgtggctcatgtcactattacaaccaagacagct
gatgggaagtgtgcgtacagagcaagttactcagatggaaaactaaaagctcctcctaaa
ccatgcgcaggcaatcaagggacccagatcacggtggaggaccttttttacaacataacc
acgagaaggaaagctttaaaaaatccaagtgaggaatatgggaaaattttggaagttgtt
ggcagatatgcaatacacaattcaggcataagcttctcagttaaaaaacaaggtgagaca
gtagctgatgttagaacactgcccagtgccacaaccgtggacaatatccggtccatcttt
ggaaatgctgtgagtcgagaactgatcgaagttgggtgtgaggataaaaccctagccttt
aaaatgagtggctacatatctaatgcgaactactctgtgaagaagtgcatcttcttactc
ttcatcaaccatcgtctggtagaatctacttcattgaggaaagccatcgaaacagtgtat
gcagcgtatttgcccaaaaacacacatcccttcctgtacctcagtttagaaatcagcccg
cagaacgtggatgtcaacgtgcaccctaccaaacacgaagttcacttcctgcacgaggag
agcatcctggagcgggtgcagcagcacatcgagagccagctgctgggctccaactcctcc
aggctgtacttcactcagactttgcttccgggacttgctggtccctctggggaggtgatt
aaatcctcagcaggtccgacgccctcatctgcttctggaagtggtgacaaagtctatgcc
caccagatggtccgtacggattcccgggaacagaagctcgatgcgtttctgcagcctccg
agcaagcccccatcccgtcagccccagaccagtgtccccgagggtaggtcagagaccatg
gccagacagcaagatgaggagatgcttgaactcccagctcctaaatgcttgaactcccag
atggctgccaggagtcaggatttggaggaggataccgccacggcaactccggaaacagca
gaagagagaggacctgcttccagcccagccaaccccagaaaaagacatcgggaagaatct
gatgtagaaatggtggaagatgattcccaaaaggagctgacagcagcttgtacccctcgg
agaaggatcatcaacctcaccagtgttctgactctccaggaggaaattaacgagcgagga
catgagactctccgggagatgctgcataaccactcctttgtgggctgtgtgaacccccag
tgggccttggcacagcatcagaccaagctgtaccttctcaacaccaccaaactcagtgaa
gaactcttctaccagatactcatttatgattttgccaattttggtgttctgaggttatcg
gagccagcaccgctgtttgacctcgccatgctcgccttagacagtcctgagagcggctgg
acagaggaagatggccccaaagaaggacttgctgagtacattgtcgagtttctgaagaag
aaggccgagatgctggcagactatttctctttggagattgatgaggaaggaaacctaaca
ggactgccccttctgattgacaactatgtgccccctttggagggactgcctatcttcatc
cttcgcctggccacagaggtgaactgggatgaagaaaaggagtgttttgaaagcctcagt
aaagaatgtgctatgttctactccgtccggaagcagtatatatctgaggagtcgacactt
tcagcccagcagaatgaagtgcctggctctgctccgaactcctggaagtgggctgtggaa
cacattgtctataaggccttccgctcacaccttctgcctcccaaacagttcacagaagat
ggcagtatcttgcagctcgctaatctacccgacctctacaaagtcttcgagagatgttaa

DBGET integrated database retrieval system