KEGG   Tupaia chinensis (Chinese tree shrew): 102489028
Entry
102489028         CDS       T02978                                 

Gene name
CELA3B
Definition
(RefSeq) proproteinase E
  KO
K01345  pancreatic endopeptidase E [EC:3.4.21.70]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04972  Pancreatic secretion
tup04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    102489028 (CELA3B)
   04974 Protein digestion and absorption
    102489028 (CELA3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tup01002]
    102489028 (CELA3B)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.70  pancreatic endopeptidase E
     102489028 (CELA3B)
Peptidases and inhibitors [BR:tup01002]
 Serine peptidases
  Family S1: chymotrypsin family
   102489028 (CELA3B)
SSDB
Motif
Pfam: Trypsin Trypsin_2
Other DBs
NCBI-GeneID: 102489028
NCBI-ProteinID: XP_006145230
LinkDB
Position
Un
AA seq 269 aa
MLRLLSLVLLVALASGCGRPSYRAGSRVVNGEDAVPYSWPWQVSLQYEKDGNFHHTCGGS
LIAPDWVMTAGHCISSSRTYQVVLGEYDRAEEEGPEQVIPINAGDLFVHPLWNPNCVACG
NDIALIKLSRSAQLGDTVQLACLPPAGDILPNETPCYISGWGRLYTNGPLPDKLQQALLP
VVDYEHCSQWDWWGLSVRKTMVCAGGDIQSGCNGDSGGPLNCPAADGSWQVHGVTSFVSA
LGCNTIKKPTVFTRVSAFNDWIQETIANH
NT seq 810 nt   +upstreamnt  +downstreamnt
atgctgcggctgctgagcttggtcctcctggtggcccttgcctcaggctgtggccgccca
tcctaccgtgccggcagccgggttgtcaatggcgaggacgcggtcccctacagttggccc
tggcaggtctccctgcagtatgagaaggacgggaacttccaccacacctgtggtggcagc
ctcatcgcccccgactgggtcatgactgcaggccactgcatctcgagctcccggacctac
caggtggtgctgggcgagtacgaccgggctgaagaggaaggccccgagcaagtgatcccc
atcaacgccggggacctctttgtgcacccgctctggaaccccaactgcgtggcctgtggc
aatgacattgccctcatcaagctgtcacgcagcgcccagctgggagacacagtccagctc
gcctgcctccccccagccggtgacatcctgcccaacgagacgccctgctacatcagtggc
tggggccgactgtacactaacgggccactcccagacaagctgcagcaggccctgctgccc
gtggtggactacgagcactgctcccagtgggactggtggggcctctctgtgaggaagacc
atggtgtgcgctggcggggacattcaatccggctgcaatggtgactctggagggcctctc
aactgccccgcagcggacggcagctggcaggttcacggcgtgaccagcttcgtctccgcc
cttggctgcaacaccatcaagaagcccacagtgttcacccgcgtctcggccttcaacgac
tggatccaggagaccattgcaaaccactag

KEGG   Tupaia chinensis (Chinese tree shrew): 102494723
Entry
102494723         CDS       T02978                                 

Gene name
CELA2A
Definition
(RefSeq) chymotrypsin-like elastase family member 2A
  KO
K01346  pancreatic elastase II [EC:3.4.21.71]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04972  Pancreatic secretion
tup04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    102494723 (CELA2A)
   04974 Protein digestion and absorption
    102494723 (CELA2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tup01002]
    102494723 (CELA2A)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.71  pancreatic elastase II
     102494723 (CELA2A)
Peptidases and inhibitors [BR:tup01002]
 Serine peptidases
  Family S1: chymotrypsin family
   102494723 (CELA2A)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 102494723
NCBI-ProteinID: XP_006145327
LinkDB
Position
Un
AA seq 269 aa
MIRTLLLCASVAAALGCGLPTYLPHLSRVVGGEDASPNSWPWQVSLQYSSSGTWRHTCGG
SLVANNWVLTAAHCISSSRTYRVLLGRHSLSTDESGSLAVQVSKLVVHEDWNSSQLSKGN
DIALLKLAEPVTLTDKIQLACLPPAGTILPNNYPCYVTGWGRLQTNGALPDILQEGQLLV
VDYATCSSPGWWGSSVKTNMVCAGGDGVISSCNGDSGGPLNCQAANGQWEVHGVVSFGSS
LGCNYYHKPSVFTRVSNYIDWINSVIANN
NT seq 810 nt   +upstreamnt  +downstreamnt
atgatcaggacactactgctgtgtgcatcggtggctgcagctctcggctgcgggctcccc
acttacctgccccacttgtccagggtggtgggaggtgaagatgcaagtcccaacagctgg
ccctggcaggtctccctacagtacagctccagtggcacctggcgccacacctgcggaggg
tccctggtggccaacaactgggtcctgacagctgcccactgcatcagctcgtccaggacc
taccgtgtgctgctgggccggcacagcctctccactgacgagtccggctcgctggctgtc
caagtttccaagcttgtggtgcacgaggactggaactccagccagctctctaaagggaat
gacattgccctgctcaaactggccgagcctgtcacgctgaccgacaagatccagctggcc
tgcctcccacctgccggcaccattctacccaacaactacccctgctacgtcacgggctgg
ggaaggctgcagaccaatggggctcttccggacatcctgcaggagggccagttgctggtg
gtggactacgccacgtgttccagccctggctggtggggcagctccgtgaagaccaacatg
gtctgtgcgggcggcgatggcgtgatctccagctgcaacggggactctggtgggccgctg
aactgccaggcggccaacggccagtgggaagtgcatggcgtggtcagctttgggtcctcc
cttggttgcaactactaccacaagccctctgtcttcacacgggtctccaactacatcgac
tggatcaattcggtgattgcgaataactaa

DBGET integrated database retrieval system