KEGG   Tupaia chinensis (Chinese tree shrew): 102489114Help
Entry
102489114         CDS       T02978                                 

Gene name
PTEN
Definition
(RefSeq) phosphatase and tensin homolog
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00562  Inositol phosphate metabolism
tup01100  Metabolic pathways
tup01521  EGFR tyrosine kinase inhibitor resistance
tup04068  FoxO signaling pathway
tup04070  Phosphatidylinositol signaling system
tup04071  Sphingolipid signaling pathway
tup04115  p53 signaling pathway
tup04140  Autophagy - animal
tup04150  mTOR signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04218  Cellular senescence
tup04510  Focal adhesion
tup04931  Insulin resistance
tup05165  Human papillomavirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05200  Pathways in cancer
tup05206  MicroRNAs in cancer
tup05213  Endometrial cancer
tup05214  Glioma
tup05215  Prostate cancer
tup05218  Melanoma
tup05222  Small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05230  Central carbon metabolism in cancer
tup05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102489114 (PTEN)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102489114 (PTEN)
   04070 Phosphatidylinositol signaling system
    102489114 (PTEN)
   04071 Sphingolipid signaling pathway
    102489114 (PTEN)
   04151 PI3K-Akt signaling pathway
    102489114 (PTEN)
   04150 mTOR signaling pathway
    102489114 (PTEN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102489114 (PTEN)
  09143 Cell growth and death
   04115 p53 signaling pathway
    102489114 (PTEN)
   04218 Cellular senescence
    102489114 (PTEN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102489114 (PTEN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102489114 (PTEN)
   05206 MicroRNAs in cancer
    102489114 (PTEN)
   05230 Central carbon metabolism in cancer
    102489114 (PTEN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102489114 (PTEN)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102489114 (PTEN)
   05214 Glioma
    102489114 (PTEN)
   05218 Melanoma
    102489114 (PTEN)
   05215 Prostate cancer
    102489114 (PTEN)
   05213 Endometrial cancer
    102489114 (PTEN)
   05224 Breast cancer
    102489114 (PTEN)
   05222 Small cell lung cancer
    102489114 (PTEN)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102489114 (PTEN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102489114 (PTEN)
   05165 Human papillomavirus infection
    102489114 (PTEN)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102489114 (PTEN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tup01009]
    102489114 (PTEN)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102489114 (PTEN)
    3.1.3.48  protein-tyrosine-phosphatase
     102489114 (PTEN)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     102489114 (PTEN)
Protein phosphatases and associated proteins [BR:tup01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    102489114 (PTEN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 102489114
NCBI-ProteinID: XP_006169808
LinkDB All DBs
Position
Un
AA seq 299 aa AA seqDB search
MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSY
LLKNHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKFMY
FEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQE
NT seq 899 nt NT seq  +upstreamnt  +downstreamnt
atgacagccatcatcaaagagatcgttagcagaaacaaaaggagatatcaagaggatgga
ttcgacttagacttgacctatatttatccaaacattattgctatgggatttcctgcagaa
agacttgaaggtgtatacaggaacaatattgatgatgtagtaaggtttttggattcaaag
cataaaaaccattacaagatatacaatctatgtgctgaaagacattatgacaccgccaaa
tttaactgcagagttgcacagtatccttttgaagaccataacccaccacagctagaactt
atcaaacccttttgcgaagatcttgaccaatggctaagtgaagatgacaatcatgttgca
gcaattcactgtaaagctggaaagggacgaactggtgtaatgatttgtgcatatttatta
catcggggcaaatttttaaaggcacaggaggccctagatttctatggggaagtaaggacc
agagacaaaaagggagtaactattcccagtcagaggcgctatgtgtattattatagctac
ctgttaaagaatcatctggattatagaccagtggcactgttgtttcacaagatgatgttt
gaaactattccaatgttcagtggcggaacttgcaatcctcagtttgtggtctgccagcta
aaggtgaagatatattcctccaattcaggaccgacacgacgagaagacaagttcatgtac
tttgagttccctcagccgttgcctgtgtgtggtgacatcaaagtcgagttcttccacaaa
cagaacaagatgctaaaaaaggacaaaatgtttcacttttgggtaaatacgtttttcata
ccaggaccagaggaaacctcagaaaaagtagaaaatggaagtctctgtgatcaagaaat

DBGET integrated database retrieval system