KEGG   Tupaia chinensis (Chinese tree shrew): 102489237
Entry
102489237         CDS       T02978                                 

Gene name
CTRB1
Definition
(RefSeq) chymotrypsinogen B
  KO
K01310  chymotrypsin [EC:3.4.21.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04972  Pancreatic secretion
tup04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    102489237 (CTRB1)
   04974 Protein digestion and absorption
    102489237 (CTRB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tup01002]
    102489237 (CTRB1)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     102489237 (CTRB1)
Peptidases and inhibitors [BR:tup01002]
 Serine peptidases
  Family S1: chymotrypsin family
   102489237 (CTRB1)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986 DUF316
Other DBs
NCBI-GeneID: 102489237
NCBI-ProteinID: XP_006152800
LinkDB
Position
Un
AA seq 305 aa
MAFLWLLSCCALLGTALSCGVPAIQPVLSGLSRIVNGEDAIPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVKTTDVVVAGEFDQGCGAWGDTTTPPPRPLLEKGSPAELRILI
VGAQGLVLLGGRREKPVPGSSQASAPYLGHLQVFKNPKFNIFTVRNDITLLKLATPAQFS
QTVSPVCLPSAQDDFPAGSLCATTGWGKTKYNGVCRAGCAAAVTGGFWSESAKAETSTPL
VRNPPSKLGTRVGDSGGPLVCQKDGAWTLVGIVSWGSGTCATSSPGVYARVTELMPWVQE
ILAAN
NT seq 918 nt   +upstreamnt  +downstreamnt
atggccttcctctggctcctctcctgctgcgccctcctgggcactgccctcagctgcggc
gtccccgccatccagcccgtgctgagcggcctgtccaggatcgtcaatggtgaggacgcc
atccccggctcctggccctggcaggtgtccctgcaggacaagaccggcttccacttctgc
gggggctccctcatcagcgaggactgggtggtcaccgccgcccactgcggggtcaagaca
actgacgtggtggtggccggggagttcgaccagggctgcggggcgtggggagacactacg
acgcccccaccccgccccctgctggagaagggcagccctgcagagctcaggatccttatt
gtgggcgcccaaggactggttctcctggggggccgcagggaaaagcctgtcccaggatcc
tcccaggcctcagctccgtatctgggtcacctgcaggttttcaagaaccccaagttcaac
attttcacggtgcgcaacgacatcaccctgctgaagctggccacgcccgcccagttctcg
cagaccgtgtcccccgtgtgcctgcccagcgcccaggacgacttccccgcgggctcgctg
tgcgccaccacgggctggggcaagaccaagtacaacggtgtgtgccgggcgggctgcgcg
gcggccgtgaccggcgggttttggtctgaatcagccaaggcggagacctccacgcccttg
gttcggaatcctccgagcaaactggggacgcgagtgggcgactccggcggccccctggtc
tgccagaaggatggagcctggaccctggtgggcattgtgtcctggggcagtggcacctgc
gccacctccagccccggcgtgtacgcgcgtgtcactgagctcatgccctgggtgcaggag
atcctggccgccaactga

KEGG   Tupaia chinensis (Chinese tree shrew): 102489643
Entry
102489643         CDS       T02978                                 

Definition
(RefSeq) chymotrypsinogen B
  KO
K01310  chymotrypsin [EC:3.4.21.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04972  Pancreatic secretion
tup04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    102489643
   04974 Protein digestion and absorption
    102489643
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tup01002]
    102489643
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     102489643
Peptidases and inhibitors [BR:tup01002]
 Serine peptidases
  Family S1: chymotrypsin family
   102489643
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986 DUF316
Other DBs
NCBI-GeneID: 102489643
NCBI-ProteinID: XP_014444926
LinkDB
Position
Un
AA seq 378 aa
MSGEARQGRFQSGWPGPVCGCVGLAGGGGTGRLTARAGEAHVGSGLCPHPPLSPPPGCGV
PAIQPVLSGLSRIVNGEDAIPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVKTT
DVVVAGEFDQGSDEENIQVLKIAQVFKNPKFNMLTVRNDITLLKLATPAQFSQTVSPVCL
PSAQDDFPAGSLCATTGWGKTKYNGVCRAGCAAAVTGGFWSESAKAETSTPLVRNPPSKL
GTRVASLVCPAAPSRRGGRPEPGLDLVRAPAVRPRAQGLPAIMVTWPRSLCPHLPFSYLP
GLHQVRVSWGPGTLSGLETNALSPQGDSGGPLVCQKDGAWTLVGIVSWGSGTCSTSTPAV
YARVTELMPWVQEILAAN
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgagtggagaggccaggcagggaagattccagagtggctggccgggaccagtgtgcggc
tgtgtgggcctggcaggaggaggtggaactgggcggctcacagcgagggcaggggaggcc
catgttggctcaggtctttgtccccacccgcccctctcaccgcccccaggctgcggcgtc
cccgccatccagcccgtgctgagcggcctgtccaggatcgtcaatggtgaggacgccatc
cccggctcctggccctggcaggtgtccctgcaggacaagaccggcttccacttctgcggg
ggctccctcatcagcgaggactgggtggtcaccgccgcccactgcggggtcaagacaact
gacgtggtggtggccggggagttcgaccagggctccgacgaggagaacatccaggtcctg
aagattgcccaggttttcaagaaccccaagttcaacatgcttacggtgcgcaacgacatc
accctgctgaagctggccacgcccgcccagttctcgcagaccgtgtcccccgtgtgcctg
cccagcgcccaggacgacttccccgcgggctcgctgtgcgccaccacgggctggggcaag
accaagtacaacggtgtgtgccgggcgggctgcgcggcggccgtgaccggcgggttttgg
tctgaatcagccaaggcggagacctccacgcccttggttcggaatcctccgagcaaactg
gggacgcgagtggccagcctggtctgcccggcagccccgagcagacgcggaggccgacca
gagcccgggctggacctagtcagggccccggcagtgcggcccagggcccaggggctgccc
gctatcatggtgacttggccacggtctctgtgcccacacttgcccttctcctacctccct
ggactccaccaggtcagggtgtcctggggccctggcaccctttcaggcttggagacaaat
gctctctccccgcagggcgactccggcggccccctggtctgccagaaggatggagcctgg
accctggtgggcatcgtgtcctggggcagtggcacctgctccacgtccacccctgcagtg
tacgcccgtgtcactgagctcatgccctgggtgcaggagatcctggccgccaactga

DBGET integrated database retrieval system