KEGG   Tupaia chinensis (Chinese tree shrew): 102489476Help
Entry
102489476         CDS       T02978                                 

Gene name
TCL1B
Definition
(RefSeq) T-cell leukemia/lymphoma 1B
  KO
K16836  T-cell leukemia/lymphoma 1B
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102489476 (TCL1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TCL1_MTCP1
Motif
Other DBs
NCBI-GeneID: 102489476
NCBI-ProteinID: XP_006165429
LinkDB All DBs
Position
Un
AA seq 131 aa AA seqDB search
MASEASPCLGPPPDCLWVRRPGIYEDEKGRTWVTVVIRLSPSQRARTRGSSGSTREPSIT
VHMWQMPVHPQKPLRPQEPSELPLSRLPVMWQLEPGRRYRATDSRLWELVDHGQVGTTEQ
MVLTQQPLGTE
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcctctgaggcttctccttgccttgggccacccccagactgcctgtgggtccggagg
cctggcatctacgaggacgagaaggggaggacctgggtgactgtggtcattcggctcagt
ccttcccaaagagctcgcaccagaggctcttctggcagcacacgtgagcccagcattacg
gtccacatgtggcagatgccagtgcacccccagaagcccctgcgtccccaggagcccagc
gagctgcccctttcccgcctgcccgttatgtggcagctcgagcccggaagaaggtaccga
gccacagactccaggctctgggagcttgtggaccacggccaggtgggcaccacagaacag
atggtcctcactcagcagccactgggcacggagtaa

DBGET integrated database retrieval system