KEGG   Tupaia chinensis (Chinese tree shrew): 102489563
Entry
102489563         CDS       T02978                                 

Gene name
GNAS
Definition
(RefSeq) guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01522  Endocrine resistance
tup04015  Rap1 signaling pathway
tup04020  Calcium signaling pathway
tup04024  cAMP signaling pathway
tup04072  Phospholipase D signaling pathway
tup04261  Adrenergic signaling in cardiomyocytes
tup04270  Vascular smooth muscle contraction
tup04540  Gap junction
tup04611  Platelet activation
tup04713  Circadian entrainment
tup04714  Thermogenesis
tup04724  Glutamatergic synapse
tup04726  Serotonergic synapse
tup04728  Dopaminergic synapse
tup04730  Long-term depression
tup04750  Inflammatory mediator regulation of TRP channels
tup04911  Insulin secretion
tup04912  GnRH signaling pathway
tup04913  Ovarian steroidogenesis
tup04915  Estrogen signaling pathway
tup04916  Melanogenesis
tup04918  Thyroid hormone synthesis
tup04921  Oxytocin signaling pathway
tup04922  Glucagon signaling pathway
tup04923  Regulation of lipolysis in adipocytes
tup04924  Renin secretion
tup04925  Aldosterone synthesis and secretion
tup04926  Relaxin signaling pathway
tup04927  Cortisol synthesis and secretion
tup04928  Parathyroid hormone synthesis, secretion and action
tup04934  Cushing syndrome
tup04935  Growth hormone synthesis, secretion and action
tup04961  Endocrine and other factor-regulated calcium reabsorption
tup04962  Vasopressin-regulated water reabsorption
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04976  Bile secretion
tup05012  Parkinson disease
tup05030  Cocaine addiction
tup05031  Amphetamine addiction
tup05032  Morphine addiction
tup05034  Alcoholism
tup05142  Chagas disease
tup05146  Amoebiasis
tup05163  Human cytomegalovirus infection
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102489563 (GNAS)
   04020 Calcium signaling pathway
    102489563 (GNAS)
   04072 Phospholipase D signaling pathway
    102489563 (GNAS)
   04024 cAMP signaling pathway
    102489563 (GNAS)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102489563 (GNAS)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102489563 (GNAS)
  09152 Endocrine system
   04911 Insulin secretion
    102489563 (GNAS)
   04922 Glucagon signaling pathway
    102489563 (GNAS)
   04923 Regulation of lipolysis in adipocytes
    102489563 (GNAS)
   04912 GnRH signaling pathway
    102489563 (GNAS)
   04913 Ovarian steroidogenesis
    102489563 (GNAS)
   04915 Estrogen signaling pathway
    102489563 (GNAS)
   04921 Oxytocin signaling pathway
    102489563 (GNAS)
   04926 Relaxin signaling pathway
    102489563 (GNAS)
   04935 Growth hormone synthesis, secretion and action
    102489563 (GNAS)
   04918 Thyroid hormone synthesis
    102489563 (GNAS)
   04928 Parathyroid hormone synthesis, secretion and action
    102489563 (GNAS)
   04916 Melanogenesis
    102489563 (GNAS)
   04924 Renin secretion
    102489563 (GNAS)
   04925 Aldosterone synthesis and secretion
    102489563 (GNAS)
   04927 Cortisol synthesis and secretion
    102489563 (GNAS)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102489563 (GNAS)
   04270 Vascular smooth muscle contraction
    102489563 (GNAS)
  09154 Digestive system
   04970 Salivary secretion
    102489563 (GNAS)
   04971 Gastric acid secretion
    102489563 (GNAS)
   04972 Pancreatic secretion
    102489563 (GNAS)
   04976 Bile secretion
    102489563 (GNAS)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102489563 (GNAS)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102489563 (GNAS)
  09156 Nervous system
   04724 Glutamatergic synapse
    102489563 (GNAS)
   04728 Dopaminergic synapse
    102489563 (GNAS)
   04726 Serotonergic synapse
    102489563 (GNAS)
   04730 Long-term depression
    102489563 (GNAS)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102489563 (GNAS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102489563 (GNAS)
   04714 Thermogenesis
    102489563 (GNAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102489563 (GNAS)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102489563 (GNAS)
  09165 Substance dependence
   05030 Cocaine addiction
    102489563 (GNAS)
   05031 Amphetamine addiction
    102489563 (GNAS)
   05032 Morphine addiction
    102489563 (GNAS)
   05034 Alcoholism
    102489563 (GNAS)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102489563 (GNAS)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102489563 (GNAS)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102489563 (GNAS)
   05165 Human papillomavirus infection
    102489563 (GNAS)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102489563 (GNAS)
   05142 Chagas disease
    102489563 (GNAS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102489563 (GNAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tup04147]
    102489563 (GNAS)
   04031 GTP-binding proteins [BR:tup04031]
    102489563 (GNAS)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102489563 (GNAS)
  Exosomal proteins of other body fluids (saliva and urine)
   102489563 (GNAS)
  Exosomal proteins of colorectal cancer cells
   102489563 (GNAS)
  Exosomal proteins of bladder cancer cells
   102489563 (GNAS)
GTP-binding proteins [BR:tup04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    102489563 (GNAS)
SSDB
Motif
Pfam: G-alpha Arf Roc Gtr1_RagA
Other DBs
NCBI-GeneID: 102489563
NCBI-ProteinID: XP_014437545
LinkDB
Position
Un
AA seq 830 aa
MGMRNCLNGNNMSGQRDIPTEPGEQPQQPSLEAPGSAAPSTGPSSAKEMETKPSHHDEPF
HIETDQKACIPPRVSRPNFQGLNPALEEAGICGGFSPPPEEFMPLAAKQPNLGGFWPTLE
HPEPPTGAYEGLQALGPAIMEPRAFCGVRPSLGGCSPPPEEAQGGCSQPLLQVPDLAPGS
PGTGVPGASRQEPRVLRPASTGFKESYSPSPEEAMPFERDGEAFGDDSPLPGLRRVIPQV
YGGSQFQAASVPSTVCLTPSPNAPPLRIPGAISSPSREPLRPPPNFMGDSPPMEISGPRL
KIGSAPTGVDDAPVNMDSPPIALDGPPLEVSGAPDKKERAERPPVEGEAAEMEGMSAASD
TEGGKVSFPGDGSPVAGAAPAAPWFRSRRSRRRRKPRRNLLRNFLIQAFGGCLGRSESPQ
PKAPRSPKVKKVPLAEKRRQMRKEALEKRAQKRAERKRSRLIDKQLQGEKLGYMCTHRLL
LLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLKEAIE
TIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYE
RSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDV
GGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRT
ISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDE
FLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
NT seq 2493 nt   +upstreamnt  +downstreamnt
atgggcatgcgcaactgcctcaacggcaataatatgtcaggacaacgcgatatccccact
gaacccggggaacagccccagcaaccatctttggaggccccagggtcagctgcccccagt
actgggcctagctcagccaaggagatggagaccaaaccgtctcaccacgatgagcccttc
cacatcgagactgaccagaaggcctgtatacccccaagggtctccaggcccaacttccag
ggcctcaacccagcactggaggaagccgggatctgtggaggcttcagtccacctcctgag
gaattcatgcccttggcggctaagcaacccaacttgggaggcttctggcctaccctggag
caccctgagccccccactggggcctacgagggcctccaggccttgggtccagccatcatg
gagcccagagccttctgtggtgtcagaccaagcctgggaggctgcagccctccaccagaa
gaagcccagggaggctgcagccaacctctcctgcaggttccagacctcgctccaggcagc
ccaggtacaggggttcccggagcttcacggcaagaacccagagtcctcaggcctgcaagc
actggtttcaaagagagctacagcccttcccctgaggaagctatgccatttgaacgtgat
ggagaagcctttggggacgacagcccactcccagggctccggcgagttatcccacaggtc
tatggtggcagccagttccaggcagcctcggtcccgagtacggtctgcctcactccctcc
ccgaacgcgcctcccctccggatccccggcgccatcagcagcccatctcgagagcctctc
agacctccccctaacttcatgggtgacagccccccgatggagatctccggaccccggctc
aagattggcagcgctcccactggggtcgacgacgctcccgtcaacatggacagcccccca
atcgcgcttgatggcccgccccttgaggtctccggagccccagataagaaggagcgagca
gagagacccccagttgagggagaagcagcagagatggaaggaatgtcagcagccagcgac
accgagggaggaaaagtctcctttcctggggatggatcccccgtcgccggggcagctcct
gctgccccatggttccgcagccgccggagccgccgccgccgcaagccccggcgcaactta
ctccgcaacttcctcatccaagctttcggaggctgcctgggtcgatctgagagtccccag
cccaaagccccgcgctcccccaaggtcaagaaggtgcctctggcggagaagcgcaggcag
atgcgcaaggaagccctggagaagcgtgcccagaagcgcgccgagagaaaacgcagcagg
ctcatcgacaagcagctgcagggcgagaagctgggctacatgtgcacgcaccgcctgctg
cttctaggtgctggagaatctggtaaaagcaccattgtgaagcagatgcggatcctgcat
gttaatgggttcaatggagagggcggcgaagaggacccgcaggctgcaaggagcaacagc
gatggtgagaaggcgacgaaggtgcaggacatcaagaacaacctgaaggaggccatcgag
accatcgtggccgccatgagcaacctggtgccccccgtggagctggccaaccccgagaac
cagttccgggtggactacatcctgagcgtgatgaacgtccccgacttcgacttccctccc
gaattctacgagcacgccaaggctctgtgggaggacgagggagtgcgtgcctgctacgag
cgctccaacgagtaccagctgatcgactgcgcccagtacttcctggacaagatcgatgtc
atcaagcaggccgactacgtgccaagtgaccaggacctgcttcgctgccgcgtcctgacc
tctgggatctttgagaccaagttccaggtggacaaagtcaacttccacatgttcgacgtg
ggcggccagcgggacgagcgccggaagtggatccagtgcttcaacgacgtgactgccatc
atcttcgtggtggccagcagcagctacaacatggtcatccgggaggacaaccagaccaac
cgcctgcaggaggccctgaacctcttcaagagcatctggaacaacaggtggctgcgcacc
atctctgtgatcctgttcctcaacaagcaagacctgcttgctgagaaggtcctcgctggg
aagtcaaagatcgaggactactttccagaattcgctcgctacactacccctgaggatgct
actcccgagcccggagaggacccacgcgtgacccgggccaagtacttcatccgcgacgag
tttctgagaatcagcaccgcgagcggagacgggcgccactactgctaccctcacttcacc
tgcgccgtggacaccgagaacatccgccgcgtgttcaacgactgccgtgacatcatccag
cgcatgcacctccggcagtacgagctgctctga

KEGG   Tupaia chinensis (Chinese tree shrew): 102501321
Entry
102501321         CDS       T02978                                 

Definition
(RefSeq) neuroendocrine secretory protein 55
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01522  Endocrine resistance
tup04015  Rap1 signaling pathway
tup04020  Calcium signaling pathway
tup04024  cAMP signaling pathway
tup04072  Phospholipase D signaling pathway
tup04261  Adrenergic signaling in cardiomyocytes
tup04270  Vascular smooth muscle contraction
tup04540  Gap junction
tup04611  Platelet activation
tup04713  Circadian entrainment
tup04714  Thermogenesis
tup04724  Glutamatergic synapse
tup04726  Serotonergic synapse
tup04728  Dopaminergic synapse
tup04730  Long-term depression
tup04750  Inflammatory mediator regulation of TRP channels
tup04911  Insulin secretion
tup04912  GnRH signaling pathway
tup04913  Ovarian steroidogenesis
tup04915  Estrogen signaling pathway
tup04916  Melanogenesis
tup04918  Thyroid hormone synthesis
tup04921  Oxytocin signaling pathway
tup04922  Glucagon signaling pathway
tup04923  Regulation of lipolysis in adipocytes
tup04924  Renin secretion
tup04925  Aldosterone synthesis and secretion
tup04926  Relaxin signaling pathway
tup04927  Cortisol synthesis and secretion
tup04928  Parathyroid hormone synthesis, secretion and action
tup04934  Cushing syndrome
tup04935  Growth hormone synthesis, secretion and action
tup04961  Endocrine and other factor-regulated calcium reabsorption
tup04962  Vasopressin-regulated water reabsorption
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04976  Bile secretion
tup05012  Parkinson disease
tup05030  Cocaine addiction
tup05031  Amphetamine addiction
tup05032  Morphine addiction
tup05034  Alcoholism
tup05142  Chagas disease
tup05146  Amoebiasis
tup05163  Human cytomegalovirus infection
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102501321
   04020 Calcium signaling pathway
    102501321
   04072 Phospholipase D signaling pathway
    102501321
   04024 cAMP signaling pathway
    102501321
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102501321
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102501321
  09152 Endocrine system
   04911 Insulin secretion
    102501321
   04922 Glucagon signaling pathway
    102501321
   04923 Regulation of lipolysis in adipocytes
    102501321
   04912 GnRH signaling pathway
    102501321
   04913 Ovarian steroidogenesis
    102501321
   04915 Estrogen signaling pathway
    102501321
   04921 Oxytocin signaling pathway
    102501321
   04926 Relaxin signaling pathway
    102501321
   04935 Growth hormone synthesis, secretion and action
    102501321
   04918 Thyroid hormone synthesis
    102501321
   04928 Parathyroid hormone synthesis, secretion and action
    102501321
   04916 Melanogenesis
    102501321
   04924 Renin secretion
    102501321
   04925 Aldosterone synthesis and secretion
    102501321
   04927 Cortisol synthesis and secretion
    102501321
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102501321
   04270 Vascular smooth muscle contraction
    102501321
  09154 Digestive system
   04970 Salivary secretion
    102501321
   04971 Gastric acid secretion
    102501321
   04972 Pancreatic secretion
    102501321
   04976 Bile secretion
    102501321
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102501321
   04961 Endocrine and other factor-regulated calcium reabsorption
    102501321
  09156 Nervous system
   04724 Glutamatergic synapse
    102501321
   04728 Dopaminergic synapse
    102501321
   04726 Serotonergic synapse
    102501321
   04730 Long-term depression
    102501321
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102501321
  09159 Environmental adaptation
   04713 Circadian entrainment
    102501321
   04714 Thermogenesis
    102501321
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102501321
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102501321
  09165 Substance dependence
   05030 Cocaine addiction
    102501321
   05031 Amphetamine addiction
    102501321
   05032 Morphine addiction
    102501321
   05034 Alcoholism
    102501321
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102501321
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102501321
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102501321
   05165 Human papillomavirus infection
    102501321
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102501321
   05142 Chagas disease
    102501321
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102501321
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tup04147]
    102501321
   04031 GTP-binding proteins [BR:tup04031]
    102501321
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102501321
  Exosomal proteins of other body fluids (saliva and urine)
   102501321
  Exosomal proteins of colorectal cancer cells
   102501321
  Exosomal proteins of bladder cancer cells
   102501321
GTP-binding proteins [BR:tup04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    102501321
SSDB
Motif
Pfam: NESP55
Other DBs
NCBI-GeneID: 102501321
NCBI-ProteinID: XP_006142029
LinkDB
Position
Un
AA seq 436 aa
MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALATSNARAQQRAAAQQ
RRSFLNAHHRSGAQVFPEPPESESDHEHEHEHEEADLELSLPECLEYQESFDYETETETE
SEIESETDFETDPEPETAPTTEPETEPEEERGPVAPKNPHSGQSLAQRLHALKLQSPHTS
PSRAQPGIHERRGPRQGEEPEPKDKDPRDPEESEEPREEKQQRRCKPKKPTRRDPSPEQR
AAAQQRRSFLNAHHRSGAQVFPEPPESESDHEHEHEHEEADLELSLPECLEYQESFDYET
ETETESEIESETDFETDPEPETAPTTEPETEPEEERGPVAPKNPHSGQSLAQRLHALKLQ
SPHTSPSRAQPGIHERRGPRQGEEPEPKDKDPRDPEESEEPREEKQQRRCKPKKPTRRDP
SPESPSKRGPIPIRRH
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggatcgcaggtctcgggctcagcagtggcgccgagctcgccataattacaacgacctg
tgcccgcccataggccgccgcgcagccaccgcgctcctgtggctctcttgctccatcgcg
ctcctccgcgccctcgccacctccaacgcccgcgcccagcagcgcgcggctgcccagcag
cgccggagcttcctcaacgcccaccaccgctcgggcgcgcaggtattccccgagcccccc
gagtccgagtccgaccacgagcacgagcacgagcacgaggaggcagacctggagctgtcc
ctccccgagtgcctggagtaccaggaatctttcgactacgagaccgagaccgagaccgag
tccgaaatcgagtctgagaccgatttcgagaccgaccccgaacccgagaccgcccccacc
accgagccggagaccgagccagaagaggagcgcggcccggtggcgcccaagaacccccac
tccggccagtccctcgcccagcgcctgcacgctctgaagttgcaaagcccccacacctcc
cctagtcgcgcacagccaggcattcacgagcgccggggccccaggcagggggaggagccc
gagcccaaggacaaggaccccagggaccccgaagagtctgaagagcccagggaggagaag
cagcagcgccgctgcaagccgaagaagcccactcgccgcgacccgtcccccgagcagcgc
gcggctgcccagcagcgccggagcttcctcaacgcccaccaccgctcgggcgcgcaggta
ttccccgagccccccgagtccgagtccgaccacgagcacgagcacgagcacgaggaggca
gacctggagctgtccctccccgagtgcctggagtaccaggaatctttcgactacgagacc
gagaccgagaccgagtccgaaatcgagtctgagaccgatttcgagaccgaccccgaaccc
gagaccgcccccaccaccgagccggagaccgagccagaagaggagcgcggcccggtggcg
cccaagaacccccactccggccagtccctcgcccagcgcctgcacgctctgaagttgcaa
agcccccacacctcccctagtcgcgcacagccaggcattcacgagcgccggggccccagg
cagggggaggagcccgagcccaaggacaaggaccccagggaccccgaagagtctgaagag
cccagggaggagaagcagcagcgccgctgcaagccgaagaagcccactcgccgcgacccg
tcccccgagtccccttccaaaaggggacccatccccatccggcgtcactaa

DBGET integrated database retrieval system