KEGG   Tupaia chinensis (Chinese tree shrew): 102489962
Entry
102489962         CDS       T02978                                 

Gene name
SLC12A2
Definition
(RefSeq) solute carrier family 12 member 2
  KO
K10951  solute carrier family 12 (sodium/potassium/chloride transporter), member 2
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04970  Salivary secretion
tup04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:tup00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    102489962 (SLC12A2)
   04972 Pancreatic secretion
    102489962 (SLC12A2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tup01009]
    102489962 (SLC12A2)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tup02000]
    102489962 (SLC12A2)
Protein phosphatases and associated proteins [BR:tup01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102489962 (SLC12A2)
Transporters [BR:tup02000]
 Solute carrier family (SLC)
  SLC12: Electroneutral cation-coupled Cl cotransporter
   102489962 (SLC12A2)
SSDB
Motif
Pfam: SLC12 AA_permease AA_permease_N AA_permease_2
Other DBs
NCBI-GeneID: 102489962
NCBI-ProteinID: XP_006157476
LinkDB
Position
Un
AA seq 1200 aa
MEPGPTAPSSGTPRPVRVGETPAAAAGVDLPGTAVPSVLEDAAATTRGGGGGVRGEGAAA
SGDGLGRPLGPTPSQSRFQVDLVSENAGRAAAAAAASAGAGGKETPAEGKASGESGPAKG
SEEAKGRFRVNFVDPAASSSADDSLSDAAGVGGDGPNVSFQNGGDTVLSEGSSLHSGGGG
GSGHHQHYCYDTHTNTYYLRTFGHNTMDAVPRIDHYRHTATQLGEKLLRPSLAELHDELE
KEPFEDGLANGEESTPTRDAVVTYTAESKGVVKFGWIKGVLVRCMLNIWGVMLFIRLSWI
VGQAGIGLSVLVIMMATVVTTITGLSTSAIATNGFVRGGGAYYLISRSLGPEFGGAIGLI
FAFANAVAVAMYVVGFAETVVELLKEHSILMIDEINDIRIIGAITVVILLGISVAGMEWE
AKAQIVLLVILLLAIADFVIGTFIPLESKKPKGFFGYKTEIFNENFGPDFREEETFFSVF
AIFFPAATGILAGANISGDLADPQSAIPKGTLLAILITTLVYVGIAVSVGSCVVRDATGN
VNDTIVTELTNCTSAACKLNFDFSFCESNPCPYGLMNNFQVMSMVSGFAPLISAGIFSAT
LSSALASLVSAPKIFQALCKDNIYPAFQMFAKGYGKNNEPLRGYILTFLIALGFILIAEL
NVIAPIISNFFLASYALINFSVFHASLAKSPGWRPAFKYYNMWISLIGAILCCIVMFVIN
WWAALLTYVIVLGLYIYVTYKKPDVNWGSSTQALTYLNALQHSIRLSGVEDHVKNFRPQC
LVMTGAPNSRPALLHLVHDFTKNVGLMICGHVHMGPRRQAMKEMSIDQIKYQRWLIKNKM
KAFYAPVHADDLREGAQYLMQAAGLGRMKPNTLVLGFKKDWLQADMRDVDMYINLFHDAF
DIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGAKDVVLSMEYSKKSDIDTSKQCEKI
VKQKDEEEDGKTPTQPLLKKESKGPIVPLNVADQKLLEASTQFQKKQGKNTIDVWWLFDD
GGLTLLIPYLLTTKKKWKDCKIRVFIGGKINRIDHDRRAMATLLSKFRIDFSDIMVLGDI
NTKPKKENIAAFDEMIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYRQIRL
NELLKEHSNTANIIVMSLPVARKGAVSSALYMAWLEALSKDLPPILLVRGNHQSVLTFYS
NT seq 3603 nt   +upstreamnt  +downstreamnt
atggagccggggcccacggcgccctcctctggcaccccgaggccggtcagggtcggggag
acgccggcggcagctgccggggtggacttgcctggtacggcggtgccctcggtactggag
gatgctgcagccacaacccggggcggcggcggcggggtccgcggtgagggcgcggcggca
tctggggacgggctgggaagaccgctggggcccaccccgagccagagccgcttccaggtg
gacctggtttctgagaacgccgggcgggcggcggcggcggcagcggctagtgccggagcg
gggggcaaggagacccccgcggaagggaaagccagcggcgagagcgggcccgccaagggg
agcgaggaagccaagggccgcttccgcgtgaactttgtggacccggctgcctcctcctcg
gcggacgacagcctgtcggatgcggcgggggtcggaggcgatgggcccaacgtgagcttc
cagaacggcggggacacggtgctgagcgagggcagcagcttgcactcgggcggcggcggc
ggcagtgggcaccaccaacactactgctatgacactcacaccaacacctactacttgcgc
accttcggccacaacacgatggacgcggtgcccaggatcgaccactaccggcacacggcc
acgcagctgggcgagaagctcctccggcccagcctggcggagctccacgacgagttggaa
aaggaaccttttgaggatggccttgcaaatggggaagaaagtactccaaccagagatgct
gtggtcacatacactgcagaaagtaaaggagttgtgaagtttggctggatcaagggtgta
ctggtacgttgtatgttaaacatttggggtgtgatgctcttcattagattgtcatggatt
gtggggcaggctggaataggtctgtcagtccttgtaataatgatggccaccgttgtaaca
accatcacaggattgtctacttcagcaatagctactaatggatttgtaagaggaggagga
gcatattatttaatatctagaagtctagggccagaatttggtggtgcaattggcctgatc
ttcgcttttgccaatgctgtcgcagttgccatgtatgtggttggatttgcagaaactgtg
gtagagttgcttaaggagcattctatacttatgatagatgaaatcaatgatatccgaatt
attggagccattacagtggtgattcttttaggtatctcagtagctggaatggagtgggaa
gcaaaagctcagattgttcttttggtgatcctgctgcttgctattgctgatttcgtcata
ggaacatttatcccattggagagcaagaagcccaaaggtttctttggttataaaactgaa
atatttaatgagaactttggaccagattttcgagaggaagagactttcttttctgtgttt
gccatcttttttcctgctgcaactggtattctggccggagcaaatatctcaggtgatctt
gcagatcctcagtcagccatacccaaaggaacactcttagccattttaattactacgctg
gtttacgtaggaattgcagtatctgtaggttcttgtgttgttcgagatgccaccgggaac
gtgaatgacactatcgtaacagagctgacaaattgtacttctgcagcctgcaagttaaac
tttgacttttcattttgtgaaagcaatccttgtccatacggcctaatgaacaacttccag
gtaatgagcatggtgtcaggatttgcaccattaatttctgcaggtattttttcagccact
ctttcttcagcattggcatcccttgtgagcgctcccaaaatatttcaggctctatgtaag
gacaacatctacccagctttccagatgtttgccaaaggctatgggaaaaataatgaacct
cttcgtggctacatcttaacattcttaattgcacttggattcatcttaattgctgaactg
aatgttattgctccaattatctccaatttcttccttgcatcatatgctttgatcaacttt
tcagtattccatgcatcacttgcaaaatctccaggatggcgtcctgcattcaaatactac
aacatgtggatatcacttattggagcaattctttgttgcatagtgatgtttgtcattaat
tggtgggctgcattgctaacgtatgtcatagtccttggactgtatatttatgttacctac
aaaaaaccagatgtgaactggggatcctctactcaagccctgacttacctgaatgcactg
cagcattcaatccgtctttcaggagtggaagaccatgtgaaaaacttcaggccccagtgt
cttgttatgacgggtgctccaaactcacgcccagctttacttcatcttgttcatgatttc
acaaagaatgttggcttaatgatctgtggccatgtacatatgggtcctcgaaggcaagcc
atgaaagagatgtcaattgatcaaattaagtatcagcgatggcttattaaaaacaaaatg
aaggcattttatgctccagtacatgcagatgacttgagagaaggtgcacagtatctaatg
caggctgctggtcttggtcgtatgaaaccaaacacacttgttcttgggtttaagaaagat
tggttgcaagcagatatgagagatgtggatatgtatataaacttatttcatgacgccttt
gacatacaatacggagtagtggttattcgcctaaaagaaggactggatatatctcatctt
caaggacaagaagaattattgtcatcacaagagaaatctcctggtgccaaggatgtagta
ctaagtatggagtatagtaaaaaatcggatatagatacttccaaacaatgtgaaaaaatt
gttaaacagaaagatgaggaagaggatggcaagactccaactcaaccactgttgaaaaaa
gaatccaaaggccctattgtgcctttaaatgtagccgaccaaaagcttcttgaagctagt
acacagtttcagaaaaaacaagggaagaatactattgacgtctggtggctttttgatgat
ggaggtttgaccttattgattccttatcttctgactaccaagaaaaagtggaaagattgt
aagatcagagtattcattggtggaaaaataaacagaatagaccatgaccggagagcgatg
gctactttgcttagcaagttccggatcgacttctctgatatcatggttctaggagatatc
aataccaaaccaaagaaagaaaatattgcagcttttgatgaaatgattgagccatacaga
cttcatgaagatgataaagaacaagatattgcagataaaatgaaagaagatgaaccatgg
cgaataacagataatgagcttgaactttataagaccaagacataccggcagatcaggtta
aatgaattattaaaggagcattcaaacacagctaatattattgtcatgagtctcccagtt
gcacgaaaaggtgcggtgtccagtgctctctacatggcatggctagaagctctgtctaaa
gatctaccaccaatccttttagttcgtgggaatcatcagagtgtccttaccttctactcg
taa

DBGET integrated database retrieval system