KEGG   Tupaia chinensis (Chinese tree shrew): 102489985
Entry
102489985         CDS       T02978                                 

Gene name
CA2
Definition
(RefSeq) carbonic anhydrase 2
  KO
K18245  carbonic anhydrase 2 [EC:4.2.1.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00910  Nitrogen metabolism
tup01100  Metabolic pathways
tup04964  Proximal tubule bicarbonate reclamation
tup04966  Collecting duct acid secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    102489985 (CA2)
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    102489985 (CA2)
   04972 Pancreatic secretion
    102489985 (CA2)
   04976 Bile secretion
    102489985 (CA2)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    102489985 (CA2)
   04966 Collecting duct acid secretion
    102489985 (CA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tup04147]
    102489985 (CA2)
Enzymes [BR:tup01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     102489985 (CA2)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102489985 (CA2)
SSDB
Motif
Pfam: Carb_anhydrase
Other DBs
NCBI-GeneID: 102489985
NCBI-ProteinID: XP_014447993
LinkDB
Position
Un
AA seq 260 aa
MSHHWGYAEHNGPEHWHKDFPIAKGERQSPVDIDTRSAKHDPALKPLCLCYDKPASRRIL
NNGHSFNVEFDDSQDKTVLKEGPLEGTYRLIQFHFHWGSSDGQGSEHTVDKRKYAAELHL
VHWNTKYGDFGKAVQHPDGLAVLGVFLKIGNANPGIQKILDVLDSIKTKGKSVDFTNFDP
RSLLPGGLEYWTYPGSLTTPPLLECVTWIVLKEPISISSAQMSKFRELMFNGEGEPEELM
VDNWRPAQPLKNRQIKASFK
NT seq 783 nt   +upstreamnt  +downstreamnt
atgtcccatcactggggatacgccgagcacaacggacctgagcactggcacaaggacttc
cccatcgccaaaggggagcgccagtctccggttgacatcgacacgcggtcagccaagcat
gaccctgccctgaagcctctgtgcctgtgctatgacaaaccggcttcccggagaatcctt
aacaatggtcactctttcaacgtggagtttgatgactcccaggacaaaacagtgctgaaa
gaaggacctcttgaaggcacttacagattgattcagtttcacttccactggggttcgtct
gatggacagggttctgagcacactgtggataaaaggaagtatgcagcagagcttcacttg
gttcactggaacaccaaatacggggattttggaaaagccgtgcaacaccctgatggattg
gctgttttaggtgtttttttgaagattggcaatgctaacccaggcattcagaaaatcctt
gatgtgctggattccattaaaacaaagggcaagagtgttgacttcactaactttgatccc
cggagcctccttcctggaggactggaatattggacctacccaggctcactgaccactcct
ccccttctggaatgtgtgacctggattgtgctcaaggaacccatcagcatcagcagtgcg
cagatgtcgaaattccgtgaactgatgttcaacggtgagggagaacctgaagaactgatg
gtggacaactggcgcccagctcagccactgaagaacagacaaatcaaagcttcttttaaa
taa

DBGET integrated database retrieval system