KEGG   Tupaia chinensis (Chinese tree shrew): 102490159
Entry
102490159         CDS       T02978                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01522  Endocrine resistance
tup01524  Platinum drug resistance
tup04012  ErbB signaling pathway
tup04066  HIF-1 signaling pathway
tup04068  FoxO signaling pathway
tup04110  Cell cycle
tup04115  p53 signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04218  Cellular senescence
tup04630  JAK-STAT signaling pathway
tup04921  Oxytocin signaling pathway
tup04928  Parathyroid hormone synthesis, secretion and action
tup04934  Cushing syndrome
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05163  Human cytomegalovirus infection
tup05165  Human papillomavirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05169  Epstein-Barr virus infection
tup05200  Pathways in cancer
tup05202  Transcriptional misregulation in cancer
tup05203  Viral carcinogenesis
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05210  Colorectal cancer
tup05211  Renal cell carcinoma
tup05212  Pancreatic cancer
tup05213  Endometrial cancer
tup05214  Glioma
tup05215  Prostate cancer
tup05216  Thyroid cancer
tup05217  Basal cell carcinoma
tup05218  Melanoma
tup05219  Bladder cancer
tup05220  Chronic myeloid leukemia
tup05222  Small cell lung cancer
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102490159 (CDKN1A)
   04630 JAK-STAT signaling pathway
    102490159 (CDKN1A)
   04066 HIF-1 signaling pathway
    102490159 (CDKN1A)
   04068 FoxO signaling pathway
    102490159 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    102490159 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102490159 (CDKN1A)
   04115 p53 signaling pathway
    102490159 (CDKN1A)
   04218 Cellular senescence
    102490159 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102490159 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    102490159 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102490159 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    102490159 (CDKN1A)
   05206 MicroRNAs in cancer
    102490159 (CDKN1A)
   05205 Proteoglycans in cancer
    102490159 (CDKN1A)
   05203 Viral carcinogenesis
    102490159 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102490159 (CDKN1A)
   05212 Pancreatic cancer
    102490159 (CDKN1A)
   05225 Hepatocellular carcinoma
    102490159 (CDKN1A)
   05226 Gastric cancer
    102490159 (CDKN1A)
   05214 Glioma
    102490159 (CDKN1A)
   05216 Thyroid cancer
    102490159 (CDKN1A)
   05220 Chronic myeloid leukemia
    102490159 (CDKN1A)
   05217 Basal cell carcinoma
    102490159 (CDKN1A)
   05218 Melanoma
    102490159 (CDKN1A)
   05211 Renal cell carcinoma
    102490159 (CDKN1A)
   05219 Bladder cancer
    102490159 (CDKN1A)
   05215 Prostate cancer
    102490159 (CDKN1A)
   05213 Endometrial cancer
    102490159 (CDKN1A)
   05224 Breast cancer
    102490159 (CDKN1A)
   05222 Small cell lung cancer
    102490159 (CDKN1A)
   05223 Non-small cell lung cancer
    102490159 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102490159 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102490159 (CDKN1A)
   05161 Hepatitis B
    102490159 (CDKN1A)
   05160 Hepatitis C
    102490159 (CDKN1A)
   05163 Human cytomegalovirus infection
    102490159 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102490159 (CDKN1A)
   05169 Epstein-Barr virus infection
    102490159 (CDKN1A)
   05165 Human papillomavirus infection
    102490159 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102490159 (CDKN1A)
   01522 Endocrine resistance
    102490159 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102490159
NCBI-ProteinID: XP_006148696
LinkDB
Position
Un
AA seq 168 aa
MSEPARGARQVPCSRRCGRRVCRRLFGPVDSEQLRRDCDELMAGCVQEARERWNFDFVTE
TPLEGDFAWERVRGLGLPKVYLPAGSRDSQDDLGGGKWPSTSSALPQATAQDDHVDLLLS
CTLVPCSSERREESLGGPGASQGRKRRQTSMTDYYHSKRRRIFSKRTP
NT seq 507 nt   +upstreamnt  +downstreamnt
atgtcggagccggcgaggggtgcccgccaagtcccatgcagccgcaggtgtggccgcagg
gtgtgccgccgccttttcgggcccgtggacagcgagcagctgcgccgagactgcgacgag
ctgatggcgggctgtgtccaggaggcccgggagcggtggaacttcgacttcgtcacggag
acgccgctggagggtgacttcgcctgggagcgcgtgcggggcctcggcctgcctaaggtc
tacttgcccgcagggtcccgggacagccaagatgacctgggagggggcaagtggcccagc
acctcgtctgccctgccgcaggccacagcccaggatgaccacgtggacctgctgctgtcc
tgcaccctcgtgccttgctcctctgagcggcgagaggaatccctgggggggcctggagcc
tcccagggccggaaacggcggcagaccagcatgacagactactaccactccaaacgcagg
aggatcttctccaagaggacgccctag

DBGET integrated database retrieval system