KEGG   Tupaia chinensis (Chinese tree shrew): 102490423
Entry
102490423         CDS       T02978                                 

Gene name
EGF
Definition
(RefSeq) epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup04010  MAPK signaling pathway
tup04012  ErbB signaling pathway
tup04014  Ras signaling pathway
tup04015  Rap1 signaling pathway
tup04020  Calcium signaling pathway
tup04066  HIF-1 signaling pathway
tup04068  FoxO signaling pathway
tup04072  Phospholipase D signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04510  Focal adhesion
tup04540  Gap junction
tup04630  JAK-STAT signaling pathway
tup04810  Regulation of actin cytoskeleton
tup05160  Hepatitis C
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05210  Colorectal cancer
tup05212  Pancreatic cancer
tup05213  Endometrial cancer
tup05214  Glioma
tup05215  Prostate cancer
tup05218  Melanoma
tup05219  Bladder cancer
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05226  Gastric cancer
tup05231  Choline metabolism in cancer
tup05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102490423 (EGF)
   04012 ErbB signaling pathway
    102490423 (EGF)
   04014 Ras signaling pathway
    102490423 (EGF)
   04015 Rap1 signaling pathway
    102490423 (EGF)
   04630 JAK-STAT signaling pathway
    102490423 (EGF)
   04066 HIF-1 signaling pathway
    102490423 (EGF)
   04068 FoxO signaling pathway
    102490423 (EGF)
   04020 Calcium signaling pathway
    102490423 (EGF)
   04072 Phospholipase D signaling pathway
    102490423 (EGF)
   04151 PI3K-Akt signaling pathway
    102490423 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102490423 (EGF)
   04540 Gap junction
    102490423 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102490423 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102490423 (EGF)
   05231 Choline metabolism in cancer
    102490423 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102490423 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102490423 (EGF)
   05212 Pancreatic cancer
    102490423 (EGF)
   05226 Gastric cancer
    102490423 (EGF)
   05214 Glioma
    102490423 (EGF)
   05218 Melanoma
    102490423 (EGF)
   05219 Bladder cancer
    102490423 (EGF)
   05215 Prostate cancer
    102490423 (EGF)
   05213 Endometrial cancer
    102490423 (EGF)
   05224 Breast cancer
    102490423 (EGF)
   05223 Non-small cell lung cancer
    102490423 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102490423 (EGF)
   05165 Human papillomavirus infection
    102490423 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102490423 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tup04052]
    102490423 (EGF)
Cytokines and growth factors [BR:tup04052]
 Growth factors
  Growth factors (RTK binding)
   102490423 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF EGF_CA
Other DBs
NCBI-GeneID: 102490423
NCBI-ProteinID: XP_006162324
LinkDB
Position
Un
AA seq 1266 aa
MFTRQAMLLLFPVLLPAVSHVCVASASALQHQSCGPGAPSGSGGALRAGPLPVLVFSHGN
DIFRVDLEGTKYRRLVADAGTAVIMGFRYSEDRIYWVDLGSHVLQRVFLNGTGRERVCRI
GKSVSGMAINWVNGEILWSDPQEGAITVTDMEGGGTHTLLSTPTLPANVAVDPVERFIFW
SSEVPGSLHRASLGGADVQTLLETPDRITALSLDVLGRRLFWTQSDGEGSDPGIFSCDYG
GGSVRLCKRPMQHSLSAMSLFGEHIVYTAWREETVWVADKHSGQDLVRMRLGPSRAPPGE
LEVVHPLLQPEGRGTPGSEPKLCEPGGGGGGGSACTQQPGTREGACAEGFAWSQGRRACE
DVDECVLRTHGCTLGCENTPGAYYCTCPAGFALLPDRRRCHQLVPCPRNVTECSYGCVLT
SGGPTCFCPEGSVLEADGKTCSGELFNGGCSQLCLPLGLASWECRCLPGYALRPDNKSCT
APGPPPFLLFASSQEIRHMRFDGTDYGTLLSQPAGTVLALDYDPVENKSLCGNGRPPAPL
LDRIVLAMMHVMTLRLRAHALCSSVGSGSPRDGDPKGHAPARLVAGCVAGGEGYVLTKQA
AQTPGLRTSTSVAGRPRKNARLEGSDLNGKHRRVLVQDRVSQPRGIAVHPVAKRLFWTDS
GPKPRIESCSLQGFGRAVIASSGLAQPGGIAIDLLTHQLYWCDAGRSVVEAANLDGSQRR
TLARIHAGHPFAVAVFEDYVWFSDWATSSVTRVHKRTGGDRVRLRGSMQQPSALVVVHPL
AKPGADPCLHQNGGCAHFCQESFGAARCSCRGGFVTAPDGRSCLALSGHLVSGNPAILSH
FPRLMAGSSTPAPAWKTMWFSNLNCGCGCRAHDEPQLAADSSAGGAERLADHSCYPPPGG
DTAAGNPEPPSDTSPRASLSPESVIKSGSTLVAEVLPAISDFQAGGRVRVLSADCPMRPA
AQGPSPAPCHRSSQPKHARGFQDTRLMAGGGLSLQTVGLPVLAPHPTSPPSFLADTEACQ
PGVHRCEEAAGCAGAEGGHRCSPAGSPPGAGRNLPDSTPPSGLREDGRHPVRSSYPECPP
EYEGYCLHGGVCRYIAVLGSYACNCAVGYVGERCQHLDLQLRHASLGQQRDVTVVAVCVV
GLVLLVLLGLWGAHYYRTQKLLSKTPRNPYELPSGDACGSGPALGESGTSSCPPVWFMVI
QEHQDLGLGSPPVVGQPGQEAGVAQSSSLEPGSARPASWREPQEYGAGLELAAGSHHPVT
KTLVPR
NT seq 3801 nt   +upstreamnt  +downstreamnt
atgtttacccgtcaggcgatgctgctcctctttcccgtcctgctgccggccgtttctcac
gtgtgtgtggcgagcgcctcggcgctgcagcaccagagctgcggcccaggtgctccctcg
ggaagcgggggtgctctgcgagccggtcccctgcccgttctcgttttttcccatggaaat
gacatcttcagggtcgacctggaagggacgaagtacaggcgcctggtggccgacgccggc
actgcggtgatcatgggttttcgctacagcgaggacagaatctactgggtggatttggga
agccacgttttgcagagagttttcctgaatgggacagggcgagagagagtgtgccggatt
gggaagagtgtctctgggatggcaatcaactgggtaaatggagagatcctctggtcagac
ccccaggaaggggccatcacggtgacggacatggaaggaggcggtacccacactctgtta
agcaccccgacactccctgcgaatgtagcggttgacccggtagaaaggtttatattctgg
tcctcggaggtgcccggcagcctgcacagggccagtctgggaggtgccgacgtgcagact
ctgttggagacgccagatagaataacggctttgtctctggatgtgcttggcagacggctc
ttttggacgcagagtgatggcgaaggaagcgaccctggcattttttcctgtgattatggt
gggggctccgtgcgactttgcaaacgtcccatgcagcacagtctgtctgcaatgtccctt
ttcggtgagcacatcgtctacacagcatggagagaggagacagtttgggtagccgacaag
cacagcgggcaggatctggttagaatgcgcctcggcccttcccgggcaccgcctggcgag
cttgaggtggtgcacccgctgctgcagcccgaggggcgtggcacccctggctccgagccg
aagctttgcgagccgggtggcggtggcggaggtggcagcgcgtgcacgcagcagccgggg
acgcgggagggcgcctgtgccgaggggttcgcatggagccagggccggcgcgcctgcgaa
gacgtggacgagtgtgtgctgcggacccacggctgcacgctgggctgtgagaacaccccc
ggggcctactactgcacctgccccgcgggcttcgccctgctccccgaccgccggcgctgc
caccaattagttccctgtccacgcaacgtgaccgagtgtagctacggctgtgttctgacg
tcaggcgggcccacgtgcttctgtcctgaaggctcagtgctcgaggccgacgggaagacg
tgcagtggtgagctgttcaatggcgggtgcagccagctctgcctccctcttggcctcgcg
tcctgggaatgccggtgccttcctgggtatgccctccggccggacaacaaaagctgcaca
gctccaggaccgccgccgttcctgctgttcgccagctcccaggagatccggcacatgcgt
ttcgatgggacagactacggaaccctgcttagccagcccgcggggaccgtgctggccctc
gattacgaccctgtggaaaacaagagcctgtgcggtaacggccgcccgcctgctccgttg
ctagatcggatcgtgcttgcaatgatgcacgtcatgactctgaggctgcgcgcccacgca
ctctgctcatctgtgggctcaggctctccccgggacggagaccccaaggggcacgcgcct
gctcgcctggtggccggctgtgtggctgggggagagggctacgtcctcaccaagcaagca
gcgcaaacgcctggtctacgtaccagcacgagcgtggctgggaggccccgcaagaatgcg
cgcctcgaagggagtgacctgaacggaaagcaccgcagagtgctggtccaggaccgcgtc
tctcagccgcgaggcatcgccgtgcacccagtggccaagagattgttctggaccgactca
gggcctaagccacgaatcgaaagctgttccctgcaaggcttcggccgggcggtgatcgcc
agctccggcctggcccagcccggcgggatcgccatcgacctcctgacccaccagctgtac
tggtgcgacgccggcaggtctgtggtcgaagccgccaacctggacggctcccagcgccgg
accctggcccggatccacgcaggtcacccctttgctgtcgcggtgttcgaggattacgtg
tggttctcagactgggccacgtcctcggtgaccagggtgcacaagaggacgggtggtgac
agggtgcgactccgaggcagcatgcagcagccctcggcgctggtcgtggtccaccctctg
gcaaagccaggggcagacccctgcctacaccagaatggcggctgcgcgcacttctgccaa
gagagcttcggagctgcgcggtgctcctgtcgtggaggcttcgtgaccgccccggacggg
aggtcgtgcctggctctgagtggccatctggtgtccggtaacccagccattctaagtcac
ttccctcggctcatggcaggctcgtccaccccagcacccgcgtggaaaaccatgtggttt
tccaatctcaactgtggttgtgggtgccgggcccatgatgagcctcagctcgcagcggac
agctcagctggaggagcagaaaggctagctgaccacagctgctaccctccaccaggtggc
gacactgctgcagggaacccggagccaccctcggacacctcacccagggccagcttgtcc
ccggaaagtgtcatcaagtctgggagcacactggtggctgaggtcctgccagcaatctct
gacttccaagcaggaggcagagtccgagttctgtcggctgactgccccatgcggcctgca
gcccagggacccagccccgccccgtgtcacaggagcagccagcccaaacacgctcgcggc
tttcaggacaccaggctgatggcaggtggagggctctccttgcagactgtggggctcccc
gttcttgctccgcaccccacgtcccctccctcttttctggcagatactgaggcgtgccag
ccgggggtgcaccgctgcgaagaggccgccggctgtgcaggtgcggagggcggccaccgc
tgctccccggccggcagtcccccgggagctggaagaaatctccctgattctacgccgccc
tccggcctccgggaagacggccgccaccccgtcagaagtagctaccccgagtgtcccccg
gaatatgaggggtactgcctccacggcggcgtgtgcaggtacatcgcggtgctgggcagc
tacgcctgcaactgtgccgtcggctacgtcggggagcgctgtcagcacctggacttgcag
ctgcgccacgccagcctcgggcagcagcgggatgtcaccgtggtggctgtgtgcgtggtg
gggctggtcctcctggtcctgctggggctgtggggggcccactactacaggactcagaag
ctgctatcaaaaaccccgaggaacccttatgagctgcccagtggagacgcgtgtgggagt
gggccggcccttggagagtccgggacgtcgtcctgccctccagtgtggttcatggttatt
caggagcatcaagacctcgggcttgggagcccccctgtggtcggccagccgggccaggag
gcaggcgttgcccagtcgtcctccctggagcctgggtcagcgcggccggcatcgtggagg
gagccccaggagtatggagcaggcttggagctggctgccgggtcacaccacccagtgaca
aagactctggtccccagataa

DBGET integrated database retrieval system