KEGG   Tupaia chinensis (Chinese tree shrew): 102490451
Entry
102490451         CDS       T02978                                 

Gene name
RELA
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01523  Antifolate resistance
tup04010  MAPK signaling pathway
tup04014  Ras signaling pathway
tup04024  cAMP signaling pathway
tup04062  Chemokine signaling pathway
tup04064  NF-kappa B signaling pathway
tup04066  HIF-1 signaling pathway
tup04071  Sphingolipid signaling pathway
tup04137  Mitophagy - animal
tup04151  PI3K-Akt signaling pathway
tup04210  Apoptosis
tup04211  Longevity regulating pathway
tup04218  Cellular senescence
tup04380  Osteoclast differentiation
tup04620  Toll-like receptor signaling pathway
tup04621  NOD-like receptor signaling pathway
tup04622  RIG-I-like receptor signaling pathway
tup04623  Cytosolic DNA-sensing pathway
tup04625  C-type lectin receptor signaling pathway
tup04657  IL-17 signaling pathway
tup04658  Th1 and Th2 cell differentiation
tup04659  Th17 cell differentiation
tup04660  T cell receptor signaling pathway
tup04662  B cell receptor signaling pathway
tup04668  TNF signaling pathway
tup04722  Neurotrophin signaling pathway
tup04917  Prolactin signaling pathway
tup04920  Adipocytokine signaling pathway
tup04926  Relaxin signaling pathway
tup04931  Insulin resistance
tup04932  Non-alcoholic fatty liver disease
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05030  Cocaine addiction
tup05132  Salmonella infection
tup05133  Pertussis
tup05134  Legionellosis
tup05135  Yersinia infection
tup05140  Leishmaniasis
tup05142  Chagas disease
tup05145  Toxoplasmosis
tup05146  Amoebiasis
tup05152  Tuberculosis
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05162  Measles
tup05163  Human cytomegalovirus infection
tup05164  Influenza A
tup05165  Human papillomavirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05168  Herpes simplex virus 1 infection
tup05169  Epstein-Barr virus infection
tup05170  Human immunodeficiency virus 1 infection
tup05200  Pathways in cancer
tup05202  Transcriptional misregulation in cancer
tup05203  Viral carcinogenesis
tup05212  Pancreatic cancer
tup05215  Prostate cancer
tup05220  Chronic myeloid leukemia
tup05221  Acute myeloid leukemia
tup05222  Small cell lung cancer
tup05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tup05321  Inflammatory bowel disease
tup05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102490451 (RELA)
   04014 Ras signaling pathway
    102490451 (RELA)
   04064 NF-kappa B signaling pathway
    102490451 (RELA)
   04668 TNF signaling pathway
    102490451 (RELA)
   04066 HIF-1 signaling pathway
    102490451 (RELA)
   04071 Sphingolipid signaling pathway
    102490451 (RELA)
   04024 cAMP signaling pathway
    102490451 (RELA)
   04151 PI3K-Akt signaling pathway
    102490451 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102490451 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    102490451 (RELA)
   04218 Cellular senescence
    102490451 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102490451 (RELA)
   04621 NOD-like receptor signaling pathway
    102490451 (RELA)
   04622 RIG-I-like receptor signaling pathway
    102490451 (RELA)
   04623 Cytosolic DNA-sensing pathway
    102490451 (RELA)
   04625 C-type lectin receptor signaling pathway
    102490451 (RELA)
   04660 T cell receptor signaling pathway
    102490451 (RELA)
   04658 Th1 and Th2 cell differentiation
    102490451 (RELA)
   04659 Th17 cell differentiation
    102490451 (RELA)
   04657 IL-17 signaling pathway
    102490451 (RELA)
   04662 B cell receptor signaling pathway
    102490451 (RELA)
   04062 Chemokine signaling pathway
    102490451 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102490451 (RELA)
   04917 Prolactin signaling pathway
    102490451 (RELA)
   04926 Relaxin signaling pathway
    102490451 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102490451 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102490451 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    102490451 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102490451 (RELA)
   05202 Transcriptional misregulation in cancer
    102490451 (RELA)
   05203 Viral carcinogenesis
    102490451 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102490451 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102490451 (RELA)
   05221 Acute myeloid leukemia
    102490451 (RELA)
   05220 Chronic myeloid leukemia
    102490451 (RELA)
   05215 Prostate cancer
    102490451 (RELA)
   05222 Small cell lung cancer
    102490451 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102490451 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102490451 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    102490451 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102490451 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102490451 (RELA)
   04931 Insulin resistance
    102490451 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102490451 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102490451 (RELA)
   05135 Yersinia infection
    102490451 (RELA)
   05133 Pertussis
    102490451 (RELA)
   05134 Legionellosis
    102490451 (RELA)
   05152 Tuberculosis
    102490451 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102490451 (RELA)
   05170 Human immunodeficiency virus 1 infection
    102490451 (RELA)
   05162 Measles
    102490451 (RELA)
   05164 Influenza A
    102490451 (RELA)
   05161 Hepatitis B
    102490451 (RELA)
   05160 Hepatitis C
    102490451 (RELA)
   05168 Herpes simplex virus 1 infection
    102490451 (RELA)
   05163 Human cytomegalovirus infection
    102490451 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102490451 (RELA)
   05169 Epstein-Barr virus infection
    102490451 (RELA)
   05165 Human papillomavirus infection
    102490451 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102490451 (RELA)
   05145 Toxoplasmosis
    102490451 (RELA)
   05140 Leishmaniasis
    102490451 (RELA)
   05142 Chagas disease
    102490451 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102490451 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tup03000]
    102490451 (RELA)
Transcription factors [BR:tup03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    102490451 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 102490451
NCBI-ProteinID: XP_006149961
LinkDB
Position
Un
AA seq 593 aa
LSFLPGLGVGSASLCFASESQAGRDSVSLFRGRIPSPAPPREADLFPLIFPSEPAQASGP
YVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTK
DPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNN
PFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLQPVLSHPIFDNRAPNTAELKICRV
NRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYAD
PSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFN
GPTDPRPPPRRIAVPSRSSTSIPKPAPQPYPFPPSLSTINFDEFSSPVVFPSGQLPCQAL
ATAPTPILNQVSASAPAPAMASALAPGPAPGSVLAPGPPQPVAPPAPKTTQAGEGTLTEA
LLQLQFDADEDLGALLGNSTDPAVFTDLASVDNSEFXXXXXXGVSMPPPTAEPMLMEYPE
AITRLVTGSQRGPEPAPAPLGASGLPNGLLSGDEDFSSIADMDFSALLSQISS
NT seq 1782 nt   +upstreamnt  +downstreamnt
ctcagtttcctcccaggattgggagtggggagtgcctccctttgttttgcttctgaaagt
caagcaggccgtgactcggtttccctctttagaggcaggattccgtccccagctccccct
cgggaagcagacttgttccccctcatcttcccgtctgagcccgcacaggcctccggccct
tatgtggagatcatcgagcagcccaagcagcgcggcatgcgcttccgctacaaatgcgag
ggccgctctgctggcagtatccctggggagaggagcacggataccaccaagactcacccc
accatcaagatcaatggctacacaggaccagggacggttcgcatctccctggtcaccaag
gatccccctcacaggcctcaccctcacgagcttgtggggaaggactgccgggatggcttc
tatgaggctgagctctgcccagaccgctgcatccacagtttccagaacctggggatccag
tgtgtgaagaagcgggacttggaacaggctatcagtcaacgcatccagaccaacaacaac
cccttccaagttcccatagaagagcagcgaggggactatgacctgaatgctgtgcggctg
tgcttccaggtgacagtgcgggacccggcagggaggccactccgcctgcaacctgtcctc
tctcatcccatctttgacaaccgtgcccccaacactgctgagctcaagatctgccgagtg
aaccgaaactctgggagctgcctcggtggggatgagatcttcttgctgtgtgacaaggtg
cagaaagaggacatcgaggtgtatttcacgggaccaggctgggaggcccgaggctccttt
tcacaagctgatgtgcatcgacaagtggccatcgtgttccggacccctccctatgcagac
cccagcctgcaggcccctgtacgcgtctctatgcagctgcggcggccttccgatcgggag
ctcagtgagcccatggaattccagtacctgccagacacagatgatcgtcaccggattgag
gagaaacgcaaaaggacgtatgagactttcaagagcatcatgaagaagagtcctttcaat
ggacccaccgaccctcggcctccaccccggcgcattgctgtgccttcccgcagctcaact
tccattcccaagccagccccccagccctatccctttccaccatccctcagcaccatcaac
tttgatgagttttcttctcccgtggtgttcccttctgggcagctcccatgccaggccttg
gcaacagctcctaccccaatcctgaaccaggtctcagcctctgcccctgccccagccatg
gcatcagctctggccccaggcccagcccctggctcagtcctggcccctggccctcctcag
cctgtagccccacctgcccccaagaccacccaggctggggaaggaacactgacagaggcc
ctgctgcagctgcagtttgatgctgatgaagacctgggggccttgcttggcaatagcaca
gacccagccgtgttcacggacctggcatcggtcgacaactctgagtttnnnnnnnnnnnn
nnnnagggtgtatctatgccgccccccacagctgagcccatgttgatggagtaccctgag
gctataactcgcctggtcacagggtctcagaggggccctgaaccagctcctgcccccctg
ggggcctcagggctccccaatggcctcctctcaggggatgaagacttctcctccattgcg
gacatggacttctcagccctcctgagtcagatcagctcctaa

DBGET integrated database retrieval system