KEGG   Tupaia chinensis (Chinese tree shrew): 102490502Help
Entry
102490502         CDS       T02978                                 

Gene name
TIMP3
Definition
(RefSeq) TIMP metallopeptidase inhibitor 3
  KO
K16866  metalloproteinase inhibitor 3
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    102490502 (TIMP3)
   05205 Proteoglycans in cancer
    102490502 (TIMP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tup01002]
    102490502 (TIMP3)
Peptidases and inhibitors [BR:tup01002]
 Peptidase inhibitors
  Family I35: timp family
   102490502 (TIMP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIMP
Motif
Other DBs
NCBI-GeneID: 102490502
NCBI-ProteinID: XP_006170396
LinkDB All DBs
Position
Un
AA seq 211 aa AA seqDB search
MTPWLGLVVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTL
VYTVKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNF
VERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSK
HYACIRQKGGYCSWYRGWAPPDKSIINATDP
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgactccctggctcgggctcgtcgtactcctgggcagctggagtctgggagactggggc
gctgaggcgtgcacatgctcgcccagccacccccaggacgccttctgcaactccgacatc
gtgatccgggccaaggtggtgggaaagaagctggtgaaggaagggccctttggcactctg
gtctacaccgtcaagcagatgaagatgtatagaggcttcaccaagatgccccacgtgcaa
tacatccacacagaagcttcagaaagtctctgtggccttaagctggaggtcaacaagtac
cagtatctgctgacaggccgtgtctatgatggcaagatgtacacagggctgtgcaacttt
gtagagcggtgggaccagctcactctctcccagcgcaaggggctgaactatcggtatcac
ctgggctgtaactgcaagatcaagtcctgctattacctgccttgctttgtgacctccaag
aacgaatgtctctggaccgacatgctctccaattttggctaccctggctaccagtctaaa
cactatgcttgcatccggcagaaggggggctactgcagctggtaccgaggatgggctccc
ccggacaaaagcatcatcaatgccacagacccctga

DBGET integrated database retrieval system