KEGG   Tupaia chinensis (Chinese tree shrew): 102490651
Entry
102490651         CDS       T02978                                 

Gene name
CCND1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01522  Endocrine resistance
tup04068  FoxO signaling pathway
tup04110  Cell cycle
tup04115  p53 signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04152  AMPK signaling pathway
tup04218  Cellular senescence
tup04310  Wnt signaling pathway
tup04340  Hedgehog signaling pathway
tup04371  Apelin signaling pathway
tup04390  Hippo signaling pathway
tup04510  Focal adhesion
tup04530  Tight junction
tup04630  JAK-STAT signaling pathway
tup04917  Prolactin signaling pathway
tup04919  Thyroid hormone signaling pathway
tup04921  Oxytocin signaling pathway
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup04934  Cushing syndrome
tup05160  Hepatitis C
tup05162  Measles
tup05163  Human cytomegalovirus infection
tup05165  Human papillomavirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05169  Epstein-Barr virus infection
tup05200  Pathways in cancer
tup05203  Viral carcinogenesis
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05210  Colorectal cancer
tup05212  Pancreatic cancer
tup05213  Endometrial cancer
tup05214  Glioma
tup05215  Prostate cancer
tup05216  Thyroid cancer
tup05218  Melanoma
tup05219  Bladder cancer
tup05220  Chronic myeloid leukemia
tup05221  Acute myeloid leukemia
tup05222  Small cell lung cancer
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102490651 (CCND1)
   04340 Hedgehog signaling pathway
    102490651 (CCND1)
   04390 Hippo signaling pathway
    102490651 (CCND1)
   04371 Apelin signaling pathway
    102490651 (CCND1)
   04630 JAK-STAT signaling pathway
    102490651 (CCND1)
   04068 FoxO signaling pathway
    102490651 (CCND1)
   04151 PI3K-Akt signaling pathway
    102490651 (CCND1)
   04152 AMPK signaling pathway
    102490651 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102490651 (CCND1)
   04115 p53 signaling pathway
    102490651 (CCND1)
   04218 Cellular senescence
    102490651 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102490651 (CCND1)
   04530 Tight junction
    102490651 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102490651 (CCND1)
   04921 Oxytocin signaling pathway
    102490651 (CCND1)
   04919 Thyroid hormone signaling pathway
    102490651 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102490651 (CCND1)
   05206 MicroRNAs in cancer
    102490651 (CCND1)
   05205 Proteoglycans in cancer
    102490651 (CCND1)
   05203 Viral carcinogenesis
    102490651 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102490651 (CCND1)
   05212 Pancreatic cancer
    102490651 (CCND1)
   05225 Hepatocellular carcinoma
    102490651 (CCND1)
   05226 Gastric cancer
    102490651 (CCND1)
   05214 Glioma
    102490651 (CCND1)
   05216 Thyroid cancer
    102490651 (CCND1)
   05221 Acute myeloid leukemia
    102490651 (CCND1)
   05220 Chronic myeloid leukemia
    102490651 (CCND1)
   05218 Melanoma
    102490651 (CCND1)
   05219 Bladder cancer
    102490651 (CCND1)
   05215 Prostate cancer
    102490651 (CCND1)
   05213 Endometrial cancer
    102490651 (CCND1)
   05224 Breast cancer
    102490651 (CCND1)
   05222 Small cell lung cancer
    102490651 (CCND1)
   05223 Non-small cell lung cancer
    102490651 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102490651 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102490651 (CCND1)
   04934 Cushing syndrome
    102490651 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102490651 (CCND1)
   05162 Measles
    102490651 (CCND1)
   05160 Hepatitis C
    102490651 (CCND1)
   05163 Human cytomegalovirus infection
    102490651 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102490651 (CCND1)
   05169 Epstein-Barr virus infection
    102490651 (CCND1)
   05165 Human papillomavirus infection
    102490651 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102490651 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102490651
NCBI-ProteinID: XP_006171301
UniProt: L8Y009
LinkDB
Position
Un
AA seq 295 aa
MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKVV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLGSPNNFLSYYRLTRFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNLDPKATEEEEEEEEEVDLACTPTDVRDVDI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggaacaccagctcctatgctgcgaggtggagaccatccgccgtgcttaccctgatgcc
aacctcctcaacgaccgggtgctgagggccatgctcaaggcggaggagacctgcgcaccc
tccgtgtcttacttcaagtgtgtgcagaaggagatcctgccgtccatgcggaaggtcgtg
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaagaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagccggtgaagaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcttctaagatgaaggagaccatccccctgacg
gctgagaagttgtgcatctacactgacaattccatccggccggaggagctactgcaaatg
gagctgctcctggtgaacaagctcaagtggaacctggccgccatgacccctcacgatttc
attgagcacttcctttccaaaatgcctgaggcggaggagaacaaacagatcatccgcaaa
cacgcccagaccttcgttgccctctgtgccacagatgtgaagttcatttccaacccaccc
tccatggtggccgctgggagcgtggtggctgcagtgcaaggcctgaacctgggaagtccc
aacaacttcctgtcctactaccgcctgacgcgcttcctctccagagtcatcaagtgtgac
ccggactgtctccgggcctgtcaagagcagatcgaagccctgctggagtcaagcctgcgc
caggcccagcagaacttggaccccaaggccacagaggaagaggaggaagaggaagaagag
gttgacctggcctgcaccccgaccgatgtgcgagatgtggacatttga

DBGET integrated database retrieval system