KEGG   Tupaia chinensis (Chinese tree shrew): 102490714
Entry
102490714         CDS       T02978                                 

Gene name
CFTR
Definition
(RefSeq) cystic fibrosis transmembrane conductance regulator
  KO
K05031  cystic fibrosis transmembrane conductance regulator [EC:5.6.1.6]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup02010  ABC transporters
tup04024  cAMP signaling pathway
tup04152  AMPK signaling pathway
tup04530  Tight junction
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    102490714 (CFTR)
  09132 Signal transduction
   04024 cAMP signaling pathway
    102490714 (CFTR)
   04152 AMPK signaling pathway
    102490714 (CFTR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102490714 (CFTR)
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    102490714 (CFTR)
   04972 Pancreatic secretion
    102490714 (CFTR)
   04976 Bile secretion
    102490714 (CFTR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tup02000]
    102490714 (CFTR)
Enzymes [BR:tup01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.1  Enzymes altering polypeptide conformation or assembly
    5.6.1.6  channel-conductance-controlling ATPase
     102490714 (CFTR)
Transporters [BR:tup02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC7 subgroup
    102490714 (CFTR)
SSDB
Motif
Pfam: CFTR_R ABC_membrane ABC_tran SMC_N AAA_21 AAA_29 RsgA_GTPase DUF87 T2SSE AAA_16 MMR_HSR1 Zeta_toxin MeaB NTPase_1 AAA_30 NB-ARC AAA_23 Intein_splicing AAA_18
Other DBs
NCBI-GeneID: 102490714
NCBI-ProteinID: XP_006162448
LinkDB
Position
Un
AA seq 1522 aa
MIITLLPAVFRLASSVFIALQEKLLMDQADLNRYQIPNLHQRPNQSNIYVYPSSLYFSWT
RPILKKGYRQRLELSDIYQIPSADSADNLSEKLEREWDRELASKKNPKLINALRRCFFWR
FTFYGILLYLGEVTKAVQPLLLGRIIASYDPENKAERSIAIYLAIGLCLLFIVRMLLLHP
AIFGLHHIGMQMRIALFSLIYKKTLKLSSRVLDKISIGQLVSLLSNNLNKFDEGLAVAHF
VWIAPLQVTLLMGLIWELLQASAFCGLGFLIVLALFQAGLGRMMMKYRDQRAGKINERLV
ITSEMIENIQSVKAYCWEEAMEKMIENLRQTELKLTRKAAYVRFFNSSAFFFSGFFVVLL
SVFPYALIKGIILRKIFTTISFCIVLRMAVTRQFPWSVQTWYDSLGAINKIQDFLQKQEY
KTLEYNLTTTEVVMENVTAFWDEGFGELLEKAKQNNNNRKISNGDNNLFFSNFSLFGSPV
LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPG
TIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGVTLSGGQRARISLAR
AVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILH
EGSSYFYGTFSELQNLRPDFSSKLMGFDSYDQFTAERRNSILTETLRRFSLEGDNAVPWN
ETKKQSFKQTGEFGEKRKNSILNSINSMRKFSVAQKTPLQMNGIEEDFDEPLERRLSLIP
DSEQGEAILPRSNVINAAPTFQGCRRQSVLNLMTQSVNQSQSVHRKATGPTRKMSLAPQA
NLTEMDIYSRRLSQESGLDISEEINEEDLKECFFDDVESVPTVTTWNTYLRYITVHKSLL
FVLIWCFVVLLVEVALSLVLLWLLRDASPQDKGNSTNNTHNGYAVIITNTSSYYVFYIYV
GVADTLLALGIFRGLPLVHALITVSKILHNRMLHSVLQAPMSTLNTLKAGGILNRFSKDI
AILDDLLPLTIFDFVQLLLIVIGTITVVSVLKPYIFLATVPVIVAFVALRAYFLHTSQQL
KQLESEGRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQ
MRIEMIFVIFFIAITFISILTTGEGEGTVGIILTLAMNIMSTLQWAVNSSIDVDSLMRSV
SRVFKFIDMPTEESKPTKSIKPSKDDGQLSKIMIIENQHVKKDYIWPSGGQMIVKDLTAK
YTDSGNAILENISFSISPGQRVGLLGRTGSGKSTLLSALLRLLNTEGEIQIDGVSWNSIT
LQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQWNDQEIWKVAEEVGLRSVIEQFPGKLDFV
LVDGGCVLSHGHKQLICLARSVLSKAKILLLDEPSAHLDPITYQIIRRALKQAFADCTVI
LCEHRIEAMLECQRFLVIEENKVRQYESIQKLLNEKSLFRQAISYSDRVKLFPHRNSSKH
RSRSQITALKEETEEEVQETRL
NT seq 4569 nt   +upstreamnt  +downstreamnt
atgattataacacttcttcccgctgtgttcagactggcctcaagtgtcttcattgctctc
caggaaaaattactaatggatcaggcagatttgaataggtatcaaattccaaatctacat
cagagaccaaatcaatcaaatatttacgtctacccctcttctctttattttagttggacc
agaccaattttgaagaaaggttatagacagcgcctggaattgtcagacatataccaaatt
ccatcagcagattcggctgacaatctctctgaaaagttggaaagagaatgggacagagaa
ctggcttcaaagaaaaatcccaaacttattaatgcccttcgacgatgctttttctggaga
tttacgttctatggaattttactatatttgggggaagtcaccaaagcagtacaacctctc
ttgctgggaagaatcatagcttcctatgacccagaaaacaaggcagaacgttccatcgcc
atttacttagccataggcttatgccttctcttcattgtgaggatgctgctcctacaccca
gccatttttggcctccatcacattggaatgcagatgagaatagctctgtttagtctgatt
tataaaaagactttaaagctgtcaagccgtgttctggataaaataagtattggacaactt
gttagtctcctttccaacaatctgaacaaatttgatgaaggacttgcagtagcacatttc
gtgtggattgcacctttacaagtgacactcctgatgggtttgatctgggagctgttacag
gcctctgccttttgcggacttggattcctgatagtgctcgccctttttcaagctggatta
gggagaatgatgatgaagtacagagatcagagagctgggaagatcaatgagagacttgtg
atcacctcagaaatgattgaaaatatccagtctgttaaagcatattgctgggaggaagca
atggaaaaaatgattgaaaacctaagacaaacagaactgaaactcacccggaaggcggcc
tatgtgagattcttcaatagctcagccttcttcttctcagggttctttgttgtgctttta
tccgtgtttccctatgcactgattaaaggaatcatccttcgaaaaatattcacaaccatt
tcattctgcatcgttctgcgcatggcagtcactcggcaattcccctggtctgtacaaaca
tggtatgactctcttggagcaataaacaaaatacaggatttcttacaaaagcaagagtat
aagactttggaatataacttaacaactacggaagtagtcatggagaatgtgacagccttt
tgggatgagggatttggagaattattagaaaaagcaaaacaaaacaataacaatagaaaa
atttccaatggagataataacctcttcttcagtaatttttcactctttggttctcctgtt
ctaaaagatattaatttcaagatagaaagaggacagttgttggcagttgctggatctact
ggagctggcaagacttcacttctcatgatgattatgggagaactcgaaccatcagagggt
aaaattaagcacagtggaagaatttctttttgttctcagttttcctggattatgcctggt
accattaaagaaaacatcatctttggtgtttcctatgatgagtatagatataggagtgtc
atcaaagcatgccaactagaagaggacatctccaagtttgcagaaaaagataatatagtt
cttggagaaggtggagtcacactgagtggaggtcaacgggcaagaatttctctagcaaga
gcagtatacaaagatgctgatttgtacctattggattctccttttggatatctagatgtt
ttaacagaaaaggaaatatttgaaagctgtgtctgtaaattgatggctaacaaaactagg
atattggtcacttccaaaatggaacatttaaagaaagctgacaaaatactaattttacat
gaaggtagtagttatttttatgggacattttctgaactccaaaatctacggcctgacttt
agctcaaagctcatgggatttgattcttacgaccagtttactgcagaaagaagaaattca
atcctaactgagaccttaaggcgtttctccttagaaggggataatgctgtcccttggaat
gagacaaaaaaacaatcttttaaacaaactggagagtttggggagaaaaggaagaactct
attctcaattcaatcaactctatgagaaagttttcagttgcacaaaagactccattacaa
atgaatggcattgaagaagattttgatgaacctttagagagaagactgtccttaattcca
gattctgagcagggagaagcaatcctgcctcgaagcaatgtgatcaatgctgcccccaca
tttcagggatgtaggaggcagtctgtcctcaacttgatgacacagtcagttaaccaaagt
caaagcgttcaccgaaaggccacaggacccacaagaaaaatgtcactggcccctcaggca
aacttaactgaaatggatatatattcaagacggctatctcaagaaagtggcttggatata
agtgaagaaattaacgaagaagatttaaaggagtgcttctttgatgatgtggagagtgta
ccaacagtgaccacgtggaacacataccttcgatatattactgtccacaagagcttactt
tttgtgcttatttggtgctttgttgttttactggtcgaggtggctctttcattggttttg
ttgtggctactgagagatgcttctcctcaagacaaagggaatagtactaacaatacacat
aacggctatgcagtgattatcaccaacacaagctcctattatgttttttacatttacgtg
ggagtagcggacactttgcttgctctgggaatcttccgaggcctaccactggtgcatgct
ctaatcacagtgtccaaaattttacacaacagaatgttacattctgttcttcaagcacca
atgtcaaccctcaacacattgaaagcaggtgggattcttaatagattctccaaagatata
gctattttggatgaccttctgcctcttaccatatttgactttgtacagttgttattaatt
gtgattggaactataaccgtagtctcagtcctaaaaccctacatcttcctagccacggtg
ccagtgatagtggcttttgttgcgctaagagcatacttccttcacacctcacagcagctc
aaacaactggagtctgaaggcaggagtccaattttcactcatctcgtgacaagcttaaaa
ggactatggacacttcgtgcttttggacgacagccttactttgaaactctgttccacaaa
gctctgaatttacatactgccaactggttcttatatctctcaacactacgctggtttcaa
atgagaatagaaatgatttttgtcatctttttcattgccattaccttcatttccatttta
acaacaggtgaaggagaaggaacagttggtattattctaactttagctatgaatatcatg
agtacattgcagtgggctgtaaactccagcatagatgtggatagtttgatgcgatctgtg
agccgagtctttaagtttattgacatgccaacagaagaaagtaaacctaccaagtcaatc
aaaccgtccaaagatgatggccagctctcaaaaatcatgattattgagaatcaacacgtg
aagaaagattacatctggccctcaggggggcaaatgatcgtcaaagacctcacagcaaaa
tatacagatagtggcaatgccatactagagaacatttccttctcaataagtcctggccag
agggtgggcctcttgggaaggactgggtcagggaagagtactttgttatcagctttattg
agactgctgaacactgaaggagaaatccagattgatggtgtgtcttggaattcaataact
ttgcaacagtggaggaaagcctttggagtgataccccagaaagtgtttatcttttctgga
acatttagaaaaaatttggatccctatgaacaatggaatgatcaagaaatatggaaggtt
gcagaagaggttggactcagatctgtgatagaacagtttcctgggaagcttgattttgtc
cttgtggatgggggttgtgtcctaagccatggccacaagcagttgatatgtttggccaga
tctgttctcagtaaggcaaagatcttactgcttgatgaacctagtgctcatttggatcca
ataacataccaaatcattcgaagagctctaaagcaagcctttgctgattgcaccgtaatt
ctctgtgaacacaggatagaagcaatgttggaatgtcaacgattcttggtcatcgaagag
aacaaagtgcgtcagtatgagtccatccagaaactgctgaacgagaagagccttttccgg
caggccatcagctactcggacagggtcaagctcttcccccatcgcaactcaagcaagcac
aggtctcgatctcagattactgctctgaaggaagagacagaagaagaggtgcaagaaaca
aggctttag

DBGET integrated database retrieval system