KEGG   Tupaia chinensis (Chinese tree shrew): 102490957
Entry
102490957         CDS       T02978                                 

Gene name
PNLIPRP2
Definition
(RefSeq) pancreatic lipase related protein 2
  KO
K14075  pancreatic lipase-related protein 2 [EC:3.1.1.3]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00561  Glycerolipid metabolism
tup01100  Metabolic pathways
tup04972  Pancreatic secretion
tup04975  Fat digestion and absorption
Module
tup_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    102490957 (PNLIPRP2)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    102490957 (PNLIPRP2)
   04975 Fat digestion and absorption
    102490957 (PNLIPRP2)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     102490957 (PNLIPRP2)
SSDB
Motif
Pfam: Lipase PLAT Abhydrolase_6 Abhydrolase_3 Ser_hydrolase LIDHydrolase Retrotran_gag_3 Abhydrolase_1
Other DBs
NCBI-GeneID: 102490957
NCBI-ProteinID: XP_006142279
LinkDB
Position
Un
AA seq 469 aa
MLLSWTLGLLLLATVRGKEICYGHLGCFSNEKPWAETLQRPIKLFPWDPKDIDTRFLLYT
NENPNNYQLITATDPATIEASNFQLDRKTRFIIHGFIDKGEESWLSDMCKKMFQVEKINC
ICVDWRRGARTMYTQAVNNIRVVGAEIAFLVQVLSTELGYSPEDVHLIGHSLGAHAAAEA
GRRLGGRVGRITGLDPAEPCFQGTPEEVRLDPSDALFVDVIHTDAAPIIPFLGFGMSQKV
GHLDFFPNGGKQMPGCNKNILSTIVDINGIWEGTRDFAACNHLRSYKYYSSSILSPDGFL
GYPCSSYEKFQENGCFPCPSEGCPKMGHYADQFKGKTSAVGQTFFLNTGESGNFTSWRYK
VSVTLAGKKKVSGYIRIALYGSNGNSKQYEIFKGSLKPDASHMRDIDVDLNVGKIEKVKF
LWNNHVINILQPKLGASQITVQSGEDETEYRFCSSDTVREDVLQSLYPC
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgctgctctcctggaccctcggccttcttctgctggccactgtcagaggtaaagaaatc
tgctatggacatcttggctgcttttctaatgaaaaaccatgggcagagacccttcagcgg
cctataaagttatttccctgggaccctaaggacatcgacacccgctttctcctgtacacg
aatgaaaatccgaacaactaccaactgatcactgccactgacccagctaccattgaagct
tcaaacttccaactggaccgcaagacacgcttcatcatccacggcttcatagacaagggg
gaggagagctggctgtcagacatgtgcaagaaaatgttccaagtggaaaagataaactgc
atctgtgtggactggagacgcggggcccggacgatgtacacccaggcggtcaacaacatc
cgggtggtgggggcggagatagccttcctcgtgcaagtgctgtcgacggagctggggtac
agcccggaggacgtgcacctcatcggccacagtctcggtgcacacgcggccgcggaggcg
ggcagaaggctggggggccgcgtgggcaggatcacagggctggatccagcagagccgtgc
ttccagggcacgcctgaggaggttcgactggacccatctgatgccctgtttgtggatgtg
atccacacagatgctgcccccataatccctttcctagggtttggaatgagccaaaaggtg
ggccacctggatttctttccaaatggagggaagcaaatgcctggatgtaataaaaatatc
ctttcaaccattgttgacatcaatggaatatgggaaggaacccgcgacttcgcagcctgc
aatcacttacgaagctacaagtattactcaagcagtatcctcagcccagatggcttcctg
ggctacccctgtagctcctatgagaagtttcaagagaatggctgttttccttgtccaagt
gaaggatgccccaaaatggggcactatgctgaccagtttaaggggaaaaccagtgctgtg
ggacaaacctttttcctaaacacaggagagagtggtaactttactagttggcgatataag
gtatcagtcacactggctggaaaaaagaaagtgagtgggtacatcaggatcgctttgtac
ggaagtaatggaaactcaaaacaatatgagattttcaaaggatccctcaaaccagatgca
agtcacatgcgtgacattgatgtggacctcaatgttggaaaaattgagaaagttaaattc
ctctggaacaatcacgtgataaatatcctccaacccaaactgggagcttctcaaatcaca
gtgcaaagtggcgaagatgagactgagtatcgtttttgcagcagcgacactgtgcgagaa
gatgttttacagtctctttacccttgttaa

DBGET integrated database retrieval system