KEGG   Tupaia chinensis (Chinese tree shrew): 102491632
Entry
102491632         CDS       T02978                                 

Gene name
TPCN2
Definition
(RefSeq) two pore segment channel 2
  KO
K14077  two pore calcium channel protein 2
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04020  Calcium signaling pathway
tup04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102491632 (TPCN2)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    102491632 (TPCN2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tup04040]
    102491632 (TPCN2)
Ion channels [BR:tup04040]
 Voltage-gated cation channels
  Calcium channel, two-pore (TPC)
   102491632 (TPCN2)
SSDB
Motif
Pfam: Ion_trans DUF3671
Other DBs
NCBI-GeneID: 102491632
NCBI-ProteinID: XP_014440812
LinkDB
Position
Un
AA seq 748 aa
MAEQESEPLLGWSRGSDRDCPAALCTCQSIQVDSGAVARQDLCIDQAVVFIEDAIQYRSI
NHRMDARSMWLYRWYYSNICQRTLGFAIFLILALAFIETPSSLTRTADVRYRSPPWEPPC
GLTESIEGLCLLLFVADVSVKGYLVGWAEILKNLWLLAYLVVLVVSLMDWTVSLSLVCRE
PLRIRRLLRPFFLLQNSSMMKKTLKCLRWSLPDMASVGLLLTIHLCLFTMFGMLLFTGEK
DNGQDKERLTYFRNLPEALTSLLVLLTTANNPDVMIPAYSKNRAYAIFFIVFTVIGSLFL
MNLLTAIIYNQFRGYLMKSLQTSLLRRRLGTRAAYEVLSSMTKEGEASPQAVGVKPQNFL
KVLHKVQLDGSHKQAIMERVRSYHGALLPADEFQKLFNEVDKSVIKEHPPRPEYQSPFLQ
SAQFLFGHYYFDYLGNFIALANIVSVCAFLVLDSDVLPRDRDDFVLGILNCVFILYYVLE
MLLKIFALGPQGYLFYRSNVFDGILTIVLLVLEISTLAVYRFPHPGWKPEMLGLLSLWDM
TRLVNMLIVFRFLRIIPNMKPMAVVASTILGLIQNMRAFGGMLVVVYYVFAIIGISLFRG
VIVAPGNSSLTPANSSAPCGSFEQLEYWANNFDDFAAALVTLWNVMVVNNWQVFLDAYRR
YSGPWSKVYFVLWWLVSSVIWVNLFLALILEIFLHRWYPRRHLHPLAGTQEATYEVSVEL
MFRDILEEPKEEELMERLSRHPHLQLCR
NT seq 2247 nt   +upstreamnt  +downstreamnt
atggcggagcaggagtctgaacctcttctgggctggtcccgcggcagcgaccgcgattgc
ccggcggcgttgtgcacttgccaaagcatccaagtcgactctggtgctgtggccaggcag
gacctctgcatcgaccaggctgtggtcttcattgaagatgcgatccaatatcgttctatc
aaccaccgtatggatgcccgctcgatgtggctttaccgatggtattactccaacatatgc
caacggactttgggctttgccatcttcctgatcttggctttggcttttattgagacccct
tcctcgctcactagaactgcagatgtgcgctaccgctcccctccctgggagcctccctgc
ggcctgaccgagagcatcgaggggctctgcctgcttctcttcgtggctgacgtctctgtg
aagggttatctggttgggtgggcagagatcttgaagaacctctggctgctggcctacctc
gtggtgctggtcgtgtctctgatggactggactgtgtccctgagtcttgtctgtcgggag
cccctgcggatacgcaggctcctccgccccttcttcctgctgcagaactcctcaatgatg
aagaagaccttgaaatgccttaggtggtcgctgccagacatggccagtgttgggctgctg
ctgacgatccacctgtgcctcttcaccatgtttgggatgctgctgtttactggcgagaag
gacaatgggcaggacaaggagaggctgacatacttccggaacctgccagaagctctgact
tctctgctggtgctgctgaccactgccaacaatcccgacgtgatgattcctgcgtattcc
aagaaccgggcctacgccatcttcttcatagtcttcactgtgatagggagcttgttcctg
atgaacctcctgacagccatcatctacaatcagttccggggctacctgatgaaatctctc
cagacttcgctgttaaggaggagactggggacccgggctgcctatgaggtcctctcctcc
atgacgaaggagggagaagcttcccctcaggcggttggggtgaagccccagaatttcttg
aaggtgcttcataaagttcagctggatggttcccacaaacaggccatcatggagagagta
cgctcctaccacggtgccctgctgccagctgatgagtttcagaaactcttcaatgaggtt
gacaaaagtgtgatcaaagagcacccgccaaggcctgagtaccagtctccgtttctgcag
agtgcccagtttctctttggccactactactttgactacctgggaaacttcatcgccctg
gcaaacattgtgtccgtttgtgccttcctggtactagactctgacgtactgccccgtgac
cgtgatgacttcgtcctggggattctcaactgcgtcttcatcctgtactatgtgctggag
atgctgctcaagatctttgctctgggtccacaaggctacctgttctaccgcagcaatgta
tttgatggaattctcactatagttctgctggttttggagatctccactctggcagtgtac
cgattcccacacccaggctggaagccagagatgctgggcctgttgtcgctgtgggacatg
acccggctggtgaacatgctcattgtgttccggttcctgcgcatcatcccgaacatgaag
ccgatggctgtggtggccagcaccatcctgggcctgatccagaacatgcgggcatttggc
gggatgctggtggtggtgtactatgtattcgctatcattgggatcagcttgtttcgaggt
gtcattgtggctcctggaaatagcagcctgacccctgccaacagctcagcgccctgtgga
agctttgagcagctggagtactgggccaacaacttcgacgactttgcggctgccctggtc
actctgtggaacgtgatggtggtgaacaactggcaggtgttcttggacgcctaccggcgt
tactcgggcccgtggtcgaaggtctattttgtgttgtggtggctggtgtcgtctgtcatc
tgggtcaacctgttcctggctctgatcctggagatcttcctccataggtggtaccctcgc
cgtcacctgcatccccttgctgggacccaggaggccacctacgaggtgtctgtggagctt
atgttcagggatatcctggaggagccaaaggaggaggagctgatggagcggctgagccgc
caccctcacctacagctgtgcaggtga

DBGET integrated database retrieval system