KEGG   Tupaia chinensis (Chinese tree shrew): 102491755
Entry
102491755         CDS       T02978                                 

Gene name
CLCA2
Definition
(RefSeq) chloride channel accessory 2
  KO
K05028  calcium-activated chloride channel regulator 2
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04924  Renin secretion
tup04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:tup00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    102491755 (CLCA2)
  09154 Digestive system
   04972 Pancreatic secretion
    102491755 (CLCA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tup04040]
    102491755 (CLCA2)
Ion channels [BR:tup04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   102491755 (CLCA2)
SSDB
Motif
Pfam: CLCA VWA_2
Other DBs
NCBI-GeneID: 102491755
NCBI-ProteinID: XP_006169759
LinkDB
Position
Un
AA seq 943 aa
MTHRDNAGPVYSLHSVILLVALSPELLRLGAGVQLQDNGYDDLLVAINPQVPEDRNLIPN
IKEMITEASFYLFNATKRRVFFRNIKILIPSTWKANNYSKVKQESYEKANILVTDWYGGH
GDDPYTLQYRGCGEEGKYIHFTPNFLLNDNLTAGYGSRGRVFVHEWAHLRWGVFDEYNND
KPFYIDGQNQIKATRCSSDITGIFVCEKGLCPQENCIISKLFQEGCTFIYDSDQNATASI
MFMQSLSSVVEFCNASNHNQEAPNLQNQMCSLRSAWDVITDSADFNHSLPMNGTELPPPP
IFSLIQAGLKVVCLVLDVSTKMAEADRLLRLQQAAEFYLMEIVEIHTFVGIVSFNSKGEI
RSQLYQINSEDDRKLLVSYLPTTVSTEAETSVCSGLKKGFEVVEKLNGKADGSVMVLVTG
GEDEHVGHCLLTVLSSGSTIHSIAMGPSAAESLEELSHLTGGLKFFAPDHPNSNSVIDAF
SRIPSGTGDIFQQHLQLESMGENVKPHHQLKNTVTVDNSVGNDTIFLVTWQTSGPPEIVL
LDPNGRKYYTNNFITNLAFQTASLRIPGTATPGHWTYTLNNTHHSLQALKMTVTSRASSL
ALPPATVETFVERDSTHFPHPVMIYANVRKGFYPILNATVTATIETKTGDPVVLKLSDDG
AGADIIKNDGIYSRYFFSFAESGRYNLKVHVNYLPSISTSAHSIPGSHAMHVPGYITNGN
IRMNAPRKSVGRNEEKQKWGFSRVSSGGSFLVLGVPTRPHPDMFLPCKITDLEAVKVEEE
VTLSWTAPGEDLDQGQATSYEIRMSKSLRNIQRDFNSAILVNTSKLNPQLAGTKERFTFS
PKLFLHGPEHHPDGETQESHRVYVAIRAMDENALKSAVSNIVQASLYIPPNSAPALARDC
LILKGVLTAMGLIGIICLVIVATHCTLNRRKRMEKRENGTKLL
NT seq 2832 nt   +upstreamnt  +downstreamnt
atgacccacagggataatgcaggtcctgtttacagcctgcactctgtgattctcctggta
gccctgagtccagagctcctacgcctgggagccggagtacaactacaagacaatggatat
gatgacttacttgttgcaattaatcctcaggttcctgaggatcgcaatctcattccaaac
attaaggaaatgataactgaagcttcattttacctattcaatgccaccaaaagaagagtg
ttttttagaaatataaagattttaataccttccacatggaaagctaataattacagcaaa
gtaaaacaagaatcatatgaaaaggcaaatatcttagtgactgactggtatggaggccat
ggagatgatccttacaccctacaatacagagggtgtggagaagaggggaaatacattcac
tttacgcccaacttcctactaaacgataacttaacagctggctacggatcacgaggcaga
gtgtttgtccatgagtgggctcatctgcgttggggtgtgtttgatgaatataacaatgac
aaacctttctacatagatggacaaaatcaaattaaagcaacaaggtgttcatctgatatc
acaggaattttcgtgtgtgaaaaaggtctttgcccgcaagaaaactgtattattagtaaa
cttttccaggaaggatgcacatttatctatgatagtgaccaaaatgcaactgcatcaatc
atgttcatgcaaagcttgtcttctgtggttgaattctgtaatgcaagtaaccacaaccaa
gaagctccaaacctacagaatcaaatgtgcagcctcagaagtgcttgggatgtaatcaca
gactcggctgattttaatcacagccttcccatgaatgggactgagcttccacctcctccc
atattctcgctcatacaggctggcctcaaagtggtctgtttagtgttggatgtgtccacc
aagatggcggaggctgatagactccttcgacttcaacaagcggctgaattttacctgatg
gagattgttgaaattcatacctttgtaggcattgtcagtttcaatagtaaaggagaaatc
agatcgcagctataccaaataaacagcgaagatgaccgaaaactgctagtttcatatctg
cccaccactgtgtcaactgaagcagaaaccagtgtctgctcagggctgaagaaaggattt
gaggtggttgagaagttgaacgggaaagctgacggctctgtaatggtgttagtgactggg
ggagaggacgagcatgttggccactgcttactcactgtgctcagcagtggttccactatc
cactccatcgccatgggcccctctgcagctgaaagcctggaggaattgtcacatcttacg
ggaggtttaaagttcttcgctccagaccatccgaactccaatagcgtgattgacgctttt
agtagaattccctctggaactggagacatttttcaacaacatcttcagcttgaaagtatg
ggtgaaaatgttaaacctcaccaccagctgaaaaacactgtgactgtggataacagtgtg
ggcaatgacactatctttctagtaacatggcaaaccagtggtccccctgagattgtatta
ctggatcctaatggaagaaaatactacacaaataattttatcaccaatctagcttttcaa
actgctagccttcggattccaggaactgccacacctgggcactggacttacacactgaac
aatactcaccattccctccaagccttgaaaatgacagtgacctctcgagcttctagctta
gctctacccccagccactgtggaaacctttgtggaaagagacagcacccattttccccat
cctgtaatgatttatgcaaatgtgagaaaggggttttatcccattcttaatgccacggta
actgctacgattgagaccaagactggagatcctgttgtgctgaaactttctgatgatgga
gcaggtgctgatattataaaaaatgatggaatttactcgaggtattttttctcctttgct
gaaagtggtagatacaacttgaaagtccatgtcaattaccttcccagcataagcacctca
gcccactctattccagggagtcacgctatgcatgtacctggttacataacaaatggtaat
attcggatgaatgccccaaggaagtcagtgggtcgaaatgaggaaaagcagaagtggggc
tttagccgagtaagctcagggggctcctttttagtgctgggagttccaaccaggccccat
cctgacatgtttctaccatgcaaaattactgacctggaagctgtcaaagtggaagaggag
gtgactctctcatggacagcacctggagaagacttggaccagggccaggctacaagctat
gaaataagaatgagtaagagtctacggaatattcaacgtgactttaacagtgctatttta
gtgaatacatcaaagctaaatcctcagctagctggcaccaaggagaggtttacattctca
cccaaacttttcctacatggacctgaacatcaccctgatggagagacacaagaaagccac
agagtctatgtggcaatacgagcgatggatgagaatgccttaaagtctgccgtatctaac
attgtccaggcatctctgtatattcccccaaattccgctcctgcacttgccagagattgt
cttattttgaaaggggttttaacagcaatgggtttgataggaatcatttgccttgttata
gttgcaacacactgtactttaaataggagaaaaagaatggagaagagagagaacggaaca
aaattgctctga

KEGG   Tupaia chinensis (Chinese tree shrew): 102495616
Entry
102495616         CDS       T02978                                 

Gene name
CLCA4
Definition
(RefSeq) chloride channel accessory 4
  KO
K05030  calcium-activated chloride channel regulator 3/4
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04924  Renin secretion
tup04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:tup00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    102495616 (CLCA4)
  09154 Digestive system
   04972 Pancreatic secretion
    102495616 (CLCA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tup04040]
    102495616 (CLCA4)
Ion channels [BR:tup04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   102495616 (CLCA4)
SSDB
Motif
Pfam: CLCA VWA VWA_2 VWA_3 VWA_CoxE
Other DBs
NCBI-GeneID: 102495616
NCBI-ProteinID: XP_006169767
LinkDB
Position
Un
AA seq 936 aa
MGGFRGFILFLVLYLLQGSKASFIELNDNGYEGIIIAIDPGVPEDDKIIDQLMDMVTAAS
TYLFEATEKRFFFKNVSILIPENWKGNPRYKRPKLESYLHADVRVALPTLPGRDEPYTKQ
FTACAEKGEYIHFTPDFVLGKKQNEYGPSDRLFVHEWAHLRWGVFDEYNDDQPYYSAKSK
KIEATRCSTGISGMNRVYTCQGGSCIYRTCRTNSTTKLYEKDCQFFPNKVQTEKTSIMFM
QSIDSVSRFCNDKNHNREAPSLQNIKCEYRSTWEVISSSEDFKSTTPREAPPPPTTFSLL
KISPRIVCLVLDKSGSMSSDNRLNRMNQAGKFFLLNIVENGSWAGMVHFDSSASVASELI
QIVGSNERDQLVASLPPVASGGTSICTGIRTAFQVIRKLQSELDGSEIVLLTDGEDKTVS
SCVNEVKLSGAIVHVIALGPSADSAVDELRTLTGGKYYYASDDAQNNGLIDAFGDLTSGN
ADVSQKSLQLESKGLTLDSNNWMNGTVIIDSTVGKDTFFLITWKSQKPSIFLWDPSGREA
GSFTVELSTKMAYLTIPGTAKVGIWTYSLQAKTSQETLTIAVTSRAANSSVPPITVSAKM
NKDTNSFPSPMIVYAEVLQGYVPVVGAKVTAFIESTSGNTEVLELFDNGAGADSFKNDGV
YSRYFTAFKENGRYSLKVQAQGGKNSATRSFRHPPNRARYIPGWVVDGKIEGNPPRPENA
ENTQTTVEDFSRMASGGAFVVSQVTPGSVADVFPPSQITDLDATPDGDEITLTWTAPGDD
FDVGKVQQYIVRISGSILDLRDNFDNALQVNTTDLLPLEANSKQTFTFKPGNISEENATH
IFIAIQSEDKSSLRSNISNIAQVALFIPEADPSPDGNNPNPDGNHPNPDGNNPSSGVNIS
VLVLSVVGSVVVVSIIVSTTVCILKKKRSNRPRTGF
NT seq 2811 nt   +upstreamnt  +downstreamnt
atggggggtttcagaggttttattcttttcttggtcctgtacctgctgcaggggtcaaaa
gcttccttcatcgagctgaatgacaatggctatgaaggcattatcattgctatagatcct
ggtgtgccagaagatgacaaaataattgaccaactaatggacatggtgacagcagcttcc
acttacctgtttgaagccacagaaaaaagattttttttcaaaaatgtgtctatattaatt
cctgagaattggaagggaaatcctcgatacaagaggccaaaacttgaaagctacctacat
gctgatgttagagttgcactgcctaccctcccaggtagagatgaaccatacaccaagcag
ttcacagcctgtgcggaaaaaggagaatacattcatttcacccctgactttgtactggga
aagaaacaaaatgagtatggaccatcagatagactgtttgtccatgagtgggcccatctc
cgctggggagtgtttgatgagtacaacgacgatcagccttactacagtgccaagtcaaaa
aaaattgaagcaacaaggtgttccacaggtatctctggtatgaacagagtgtacacgtgt
caaggaggtagctgtatatatagaacatgtagaaccaattctacaacaaaactctatgaa
aaagactgtcaatttttccctaataaagttcagacagaaaagacatccataatgtttatg
caaagtattgactctgtctccagattctgtaatgacaaaaaccataaccgagaagctcca
agtctacaaaatataaagtgtgaatatagaagtacatgggaggtgatcagcagttctgag
gattttaaaagcaccactcctagagaggcaccaccccctccaactactttctcattgctg
aaaatcagtccaagaattgtgtgcttagttcttgataagtctggaagcatgtcgagtgat
aaccgcctaaatcgaatgaatcaagcaggaaaattttttctgctcaatattgttgaaaat
ggatcctgggcggggatggttcactttgatagtagtgccagtgttgcaagtgagctcatc
caaatagtgggcagcaatgaaagagaccagctcgtggcaagcttacctccagtagcttcc
ggaggaacttccatctgcactggaattcgaactgcatttcaggtgattagaaagctacaa
tctgaactagatggatctgaaatagtgctgctgactgatggagaagacaagactgtaagc
agctgtgttaatgaagtaaaattaagcggagccattgttcatgttattgctttgggacca
tctgctgacagtgcagtagatgagttgaggactttaacaggaggaaagtattattatgct
tcagatgatgctcagaacaatggcctcattgatgcttttggagaccttacatcaggaaat
gcggatgtctcccagaagtcactgcagcttgaaagtaaaggactaactctggatagtaac
aactggatgaacggcactgtaataattgatagcacggtgggaaaagacacattctttctc
atcacatggaagagccagaaacccagtattttcctctgggatcccagtggaagagaggca
ggaagtttcacagtggaactaagcaccaaaatggcctatctcactattccaggaactgca
aaggtgggcatttggacctacagccttcaagccaaaacaagtcaggaaacattaactatt
gcagtaacttcaagagcagcaaattcttctgtacctccaatcacagtgagtgctaaaatg
aataaagacacaaacagcttccccagcccaatgatcgtctatgcggaagttctacaaggg
tatgtacccgttgttggagccaaagtgactgctttcattgaatcaaccagtggaaataca
gaagttttggaactttttgataatggtgcaggtgctgattctttcaagaatgatggcgtc
tactccaggtattttacagcttttaaagaaaatggccgatatagcttaaaagtacaggca
caaggaggaaaaaactctgccacacgaagctttaggcatccaccgaatagagcccgttac
ataccaggctgggtggtggatgggaaaattgaagggaacccaccaaggcctgaaaatgct
gaaaatactcaaacaaccgtggaggattttagcagaatggcatctggaggtgcatttgta
gtatcacaagttacacctggttccgtggctgatgtgttcccaccaagtcaaattacagat
cttgatgccacacctgatggggatgagatcaccctaacatggacagcaccaggagatgat
tttgatgttggaaaagttcaacagtatatcgtaagaataagtggaagtatccttgatcta
agagataatttcgataatgctcttcaagtaaacactactgatctgctaccacttgaagcc
aactccaaacaaacctttacatttaagccaggaaatatctcagaagaaaatgcaacccac
atatttattgccattcaaagtgaagataaaagcagtttgagatcgaacatatccaacatt
gcacaagtagctttgtttattcctgaagcagatcctagtcctgatggaaataatcctaac
cctgatggaaatcatcctaatcctgatggaaataatcccagttctggagttaacatttct
gtgttggtgttgtcagtggttggatctgttgtagttgttagcattattgtaagtaccaca
gtgtgtattttaaagaagaaaagatcaaacagacctagaacagggttttaa

KEGG   Tupaia chinensis (Chinese tree shrew): 102496433
Entry
102496433         CDS       T02978                                 

Gene name
CLCA1
Definition
(RefSeq) chloride channel accessory 1
  KO
K05027  calcium-activated chloride channel regulator 1
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04924  Renin secretion
tup04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:tup00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    102496433 (CLCA1)
  09154 Digestive system
   04972 Pancreatic secretion
    102496433 (CLCA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tup04040]
    102496433 (CLCA1)
Ion channels [BR:tup04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   102496433 (CLCA1)
SSDB
Motif
Pfam: CLCA VWA_2 VWA
Other DBs
NCBI-GeneID: 102496433
NCBI-ProteinID: XP_006169768
LinkDB
Position
Un
AA seq 908 aa
MGSSKSSIFILTLHLLGGALSNSLIQLNNNGYEGIVIAIDPNVPEDETLIQHIKDMVTQA
SPYLFEATGKRFYFKSVAILIPETWKTKPEYMRPKLETYKNADVLVAEPNPPGNDDPYTE
QMGKCGEMGEKIYFTPDFLAGKKLVQYGPQGRTFVHEWAHLRWGVFDEYNKDQKFYLSNG
KNQAVKCSAAINGKNVVNKCQGGSCVTRPCRPDKLTGLYDKDCEFVPQSQQTEKASIMFA
QSIASVVEFCTEQNHNKEAPNLQNQRCNLRSTWEVISDSEDFKKTTPMTTQPPQPTFSLL
QIGQRIVCLVLDKSGSMSIGDRLKRLNQAAKLFLLQTVEQGSWVGMVTFDSAAHVQSELK
QINSGADRNALSASLPTVASGGTSICSGLRSAFTVIRKKYSTDGSEIALLTDGEDSSISG
CFNEVKQSGAIIHTVALGPSAAKELEELSKMTGGLQTYASDQVQNNGLIDAFGALTSGNG
LPSQRSIQLESKGLTLQDSQWMNGTVIVDSTVGKDTMFLVTWTTQSPQILLLDPTGKKQE
GFLVDTHTKMTYLQIPGTAKVGVWTYSLQTSSQTLTLTVTSRASSATVPPITATSKMNKV
TSKFPSPMVVYATIRQGASPILRAKVTALIESENGKTVTLELLDNGAGADATKNDGVYSR
YFTAYDTNGRYSVKLWALGGINAARKNVIPQQNGAIYMPGWIENGQIKWNPPRPDISKNS
QDKQQCFSRTSSGGSFVVSDVPKAPIPDLFPPCQITDLKAKLEESNLINLTWTAPGDDYD
HGTARKYIIRINNNILDLRDKFDDSLQVSTTDLIPQEANSEEVFVFKPENITFENGTDLF
IAIQAIDKVDLKSEISNIARVSLFIPPQTPPVTSVPGPNIHINSTVPGIHIIKILWKWLG
EFQVSIGG
NT seq 2727 nt   +upstreamnt  +downstreamnt
atggggtcatctaagagttctatcttcattctgacccttcatctgctaggaggggccctg
agcaactcactcattcagctgaacaataatggctatgaaggcattgtcattgcaattgac
cctaatgtgccagaagatgagacactcattcaacacataaaggacatggtgacccaggca
tctccatacctgtttgaagctacaggaaaaagattttatttcaaaagtgttgccattttg
attcctgaaacatggaagacaaaacctgagtatatgagacccaaactcgagacctacaaa
aatgctgacgttctggtggctgaacctaatcctccagggaatgatgatccctacactgag
cagatgggaaagtgtggagaaatgggtgaaaagatttatttcactcctgacttcttagca
ggaaaaaagttggttcaatatgggccacaaggaaggacatttgtccacgaatgggctcac
ctgcggtggggtgtgtttgatgagtacaacaaggaccagaagttctacttatccaatggg
aaaaaccaagcagtaaagtgctcggcagctattaatggtaaaaatgtggtaaataagtgt
cagggaggcagctgtgtcaccagaccatgcagaccagacaaattaacaggactgtatgat
aaagattgtgagttcgtgccccaaagccagcagactgagaaggcttcaataatgtttgca
caaagcattgcttctgtggttgaattctgtacagaacaaaaccacaataaagaagcccca
aacctgcaaaaccaaagatgtaatctcagaagtacatgggaagtgattagcgattctgag
gactttaagaaaaccacacctatgacgacacagccaccccagccaactttctcattgcta
cagattggacaaagaattgtgtgtttagtcctagacaagtctggaagcatgtcgattggc
gaccgccttaaacgactgaatcaagcagccaaacttttcctgctgcagacggttgagcag
gggtcctgggtcgggatggtgacgttcgacagtgctgcccatgtacagagtgaactcaaa
cagataaacagtggcgctgacaggaatgcgctctccgcaagtttacccacagtggcttca
ggagggacgtctatctgctctgggcttcgatcagcatttactgtgattaggaagaaatac
agcactgatggatctgaaatcgcactgctgacggatggagaggacagcagcatcagcggg
tgctttaacgaggtcaagcagagtggagccatcatccacacagtggccctggggccctct
gcagcgaaagaactggaggagctgtctaaaatgacaggaggcttacagacatatgcttca
gatcaagttcagaacaatggcctcattgatgcttttggggcccttacatcaggaaacgga
cttccttctcagcgttccattcagcttgagagtaagggactaaccctccaggacagtcag
tggatgaacggcacagtgattgtggacagtacagtaggaaaagatactatgttccttgtc
acctggacaacgcagtctccccaaatacttctcttggatcccactggaaagaaacaagaa
ggatttttagtggacacacacaccaaaatgacctacctccaaatcccaggcactgcgaag
gttggtgtttggacttacagtctgcaaacaagctcacaaaccctgactctgactgttacc
tcccgtgcttccagtgctaccgtgcccccaattacagcgacctccaagatgaacaaggtc
acaagcaaatttcccagccccatggtagtttatgcaactattcgccaaggagcctcacca
atcctcagggccaaagtcacagccctgattgaatcagagaatggaaaaacagttaccttg
gaattactggacaatggagcaggtgctgatgctactaagaatgacggtgtctattcaagg
tattttacagcttatgatacaaatggcagatacagtgtaaaactgtgggccttgggagga
attaatgcagccagaaagaatgtgatacctcagcagaatggagccatatacatgcctggc
tggattgagaatggtcaaataaaatggaatccaccaagacctgacattagtaagaactct
caagacaagcaacagtgtttcagcagaacgtcctcaggaggttcatttgtggtctccgat
gtcccaaaggctcccatacctgatctcttcccaccttgtcagatcactgacctgaaggcg
aaactcgaagaaagcaatctcattaatctgacgtggacagctcctggagatgattatgat
catgggacagctcgcaagtacatcattcgaataaataacaatattcttgatctcagagac
aagtttgatgattctcttcaggtgagcactacagatctcatcccacaagaagccaactct
gaggaagtctttgtgtttaaaccggaaaacatcacttttgaaaatggcacggacctcttt
attgccattcaggctattgataaggtcgacctgaaatcagaaatatccaacattgcacga
gtgtctctgtttattcctccacagactcctccagtgacttctgttcctggccctaatatt
catatcaacagcactgttcctggcattcacattataaaaatcctgtggaagtggctagga
gaattccaagtgtcaatagggggctaa

DBGET integrated database retrieval system