KEGG   Tupaia chinensis (Chinese tree shrew): 102491787
Entry
102491787         CDS       T02978                                 

Gene name
PNLIP
Definition
(RefSeq) pancreatic lipase
  KO
K14073  pancreatic triacylglycerol lipase [EC:3.1.1.3]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00561  Glycerolipid metabolism
tup01100  Metabolic pathways
tup04972  Pancreatic secretion
tup04975  Fat digestion and absorption
tup04977  Vitamin digestion and absorption
Module
tup_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    102491787 (PNLIP)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    102491787 (PNLIP)
   04975 Fat digestion and absorption
    102491787 (PNLIP)
   04977 Vitamin digestion and absorption
    102491787 (PNLIP)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     102491787 (PNLIP)
SSDB
Motif
Pfam: Lipase PLAT Abhydrolase_6 DUF900 Palm_thioest Ser_hydrolase
Other DBs
NCBI-GeneID: 102491787
NCBI-ProteinID: XP_006142281
LinkDB
Position
Un
AA seq 465 aa
MLLLWILPLLLGAATGKEVCFPRLGCFSDDAPWAGIVERPLKILPWAPKDVNTRFLLYTN
ENPDNFQEIVADPSTISDSNFNKDRKTRFIIHGFIDKGEENWLANMCKNLFQVESVNCIC
VDWKSGSRTGYTQASQNIRIVGAEVAYFVEVLQSAFEYSPASVHIIGHSLGAHAAGEAGR
RINGTIGRITGLDPAEPCFEGTPELVRLDPSDAQFVDVIHTDGAPIIPNLGFGMSQSAGH
LDFFPNGGIEMPGCQKNILSQIVDIDGIWEGTRDFVACNHLRSYKYYTDSILNPDGFAGF
PCSSYSVFTANKCFPCPSEGCPQMGHYADRFPGKTAGEGQKFYLNTGDASNFARWRYQVA
VTLSGRKVTGHVLVSLFGSKGNTKQYEIFKGTLRPDSTHSNEFDSDVDVGDVQMVKFVWY
NNVINPTLPRVGASKITVERNDGQVFNFCSLETVREDVLLTLKPC
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgctactcctctggatacttccattgctgctgggagcagcaacaggaaaagaagtctgc
ttcccaagactcggctgcttcagcgatgatgccccatgggcaggaattgtggaaaggccc
cttaaaatattgccctgggctccaaaagatgtcaacactcgcttcctcttatatactaat
gagaacccagacaacttccaagaaattgtggcagatccatcaactatcagtgactccaat
ttcaacaaagacagaaaaactcgctttattattcacggattcatagacaagggagaagaa
aactggctggccaatatgtgcaagaatttgtttcaagtagaaagtgtgaactgtatctgt
gtggactggaaaagtggctcccgaactggatacacacaggcctcacagaacatccggatt
gtgggggcagaagtggcatattttgttgaagttcttcagtcagcatttgagtactcgcca
gccagtgtccacatcatcggccacagcctgggtgcccatgctgctggcgaggctggaagg
aggatcaatgggactattggacgaatcacagggttggatccagctgagccctgctttgaa
ggcacacctgaattagtccgactggatcccagcgatgcccaatttgtggatgtaattcac
acagacggtgcccccatcattcccaacttggggtttggaatgagccaatctgcaggtcac
ctagatttctttccaaatggaggaatagaaatgcccggatgtcagaagaacattctctct
cagattgttgacatagatggcatctgggaagggactcgtgactttgtggcctgtaaccac
ttaagaagctacaagtactacacggatagcatcctgaaccctgatggtttcgccggattc
ccgtgttcctcttacagtgttttcactgcaaacaagtgcttcccctgtccaagtgaaggc
tgcccgcagatgggtcattatgctgatagatttcccgggaaaactgctggagagggccag
aaattttatctgaacactggtgatgccagtaattttgcccgctggcggtaccaggtagcc
gtcacgttgtctgggaggaaggttacgggacacgtgctggtttctttgtttggaagtaaa
ggcaacactaagcagtatgaaattttcaagggcactctccgaccagacagcactcattcc
aatgagtttgactcagacgtggatgtcggggacgtgcagatggttaaatttgtttggtac
aacaatgtgatcaacccaactctacccagagtgggagcatcgaagatcacggtggaaaga
aacgatggacaagtgttcaacttctgtagcctagaaaccgtgagggaggacgttctgctc
actcttaagccatgctag

DBGET integrated database retrieval system