KEGG   Tupaia chinensis (Chinese tree shrew): 102492140Help
Entry
102492140         CDS       T02978                                 

Gene name
GCK
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00010  Glycolysis / Gluconeogenesis
tup00052  Galactose metabolism
tup00500  Starch and sucrose metabolism
tup00520  Amino sugar and nucleotide sugar metabolism
tup00524  Neomycin, kanamycin and gentamicin biosynthesis
tup01100  Metabolic pathways
tup01200  Carbon metabolism
tup04910  Insulin signaling pathway
tup04911  Insulin secretion
tup04917  Prolactin signaling pathway
tup04922  Glucagon signaling pathway
tup04930  Type II diabetes mellitus
tup04950  Maturity onset diabetes of the young
tup05230  Central carbon metabolism in cancer
Module
tup_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tup_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102492140 (GCK)
   00052 Galactose metabolism
    102492140 (GCK)
   00500 Starch and sucrose metabolism
    102492140 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    102492140 (GCK)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102492140 (GCK)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102492140 (GCK)
   04910 Insulin signaling pathway
    102492140 (GCK)
   04922 Glucagon signaling pathway
    102492140 (GCK)
   04917 Prolactin signaling pathway
    102492140 (GCK)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    102492140 (GCK)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    102492140 (GCK)
   04950 Maturity onset diabetes of the young
    102492140 (GCK)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     102492140 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 102492140
NCBI-ProteinID: XP_006166077
UniProt: L8YBQ4
LinkDB All DBs
Position
Un
AA seq 467 aa AA seqDB search
MASDHTAKNQPQTALTLVEQILAEFQLQEEDLKKVMRRMQKEMARGLRLETHEEASVKML
PTYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEAGQWSVKTTHQMYSIPEDAMTGT
AEMLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEG
NNIVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHKCEVGMIVGTGCNACYMEEM
QNVELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRVVDENSANPGQQLYEKLIGGKYM
GELVRLVLLKLVDENLLFHGEASDQLRTRGAFETRFVSQVESDSGDRKQIHNILSTLGLR
PSAADCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPS
FKERFHASVRRLTPSCEITFIESEEGSGRGAALVSAVACKKACMLGQ
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcagatcacacagcaaagaaccagccccagacagccttgactctggtggagcag
atcctggcggagttccagctacaagaggaggacctgaagaaggtgatgaggcggatgcag
aaggagatggcccgtggcctgaggctagagacccacgaggaggccagtgtgaagatgcta
cccacctacgtgcgttccaccccggaaggctcagaagtcggcgactttctctccctggac
ctgggcggcaccaacttcagggtgatgctggtgaaggtgggggagggcgaggcaggccag
tggagcgtgaagaccacgcaccagatgtactccatccccgaggacgccatgacgggcacc
gctgagatgctcttcgactacatctctgagtgcatctctgacttcttggacaagcatcag
atgaagcacaagaaactgcccctgggctttaccttttccttccccgtgaggcatgaggac
atcgacaagggcatccttctcaactggaccaagggcttcaaggcctcaggagctgaaggg
aacaacattgtggggcttctacgagatgccattaaaaggagaggggactttgagatggac
gtggtggcaatggtgaacgacacagtagccacgatgatctcctgctactacgaagaccac
aagtgtgaggtcggcatgattgtgggcactggctgcaacgcctgctacatggaggagatg
cagaacgtggagctggtggagggcgacgagggccgcatgtgtgtcaatacggagtggggc
gcctttggggactcgggcgagctggacgagttcctgctggagtacgaccgcgtggtggat
gagaactccgcgaaccccggtcagcagctgtacgagaagctcatcggcggcaaatacatg
ggcgagctggtacggctggtgctgctcaagcttgtggacgagaacctgctcttccatggg
gaggcctcggaccagctgcgcacacgcggcgcattcgagacacgcttcgtgtcgcaggtg
gagagcgactctggcgaccgcaagcagatccacaacatactgagcacgctggggctgcgg
ccctccgctgccgactgcgacatcgtgcgccgcgcctgcgagagtgtgtccacgcgcgcc
gcgcacatgtgctcggccgggctggcaggtgttatcaaccgcatgcgcgagagccgcagc
gaggatgtgatgcgcatcacagtgggcgtggacggctcagtgtacaagctgcaccccagc
ttcaaggagcggttccacgccagcgtgcgcaggctgacgcccagctgcgagatcaccttc
attgagtcggaggaaggcagtggccggggtgcggccctggtctcagctgtggcctgcaaa
aaggcctgcatgctgggccagtga

DBGET integrated database retrieval system