KEGG   Tupaia chinensis (Chinese tree shrew): 102492738
Entry
102492738         CDS       T02978                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup04062  Chemokine signaling pathway
tup04066  HIF-1 signaling pathway
tup04068  FoxO signaling pathway
tup04217  Necroptosis
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04630  JAK-STAT signaling pathway
tup04659  Th17 cell differentiation
tup04917  Prolactin signaling pathway
tup04920  Adipocytokine signaling pathway
tup04931  Insulin resistance
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup04935  Growth hormone synthesis, secretion and action
tup05145  Toxoplasmosis
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05162  Measles
tup05163  Human cytomegalovirus infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05169  Epstein-Barr virus infection
tup05200  Pathways in cancer
tup05203  Viral carcinogenesis
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05212  Pancreatic cancer
tup05221  Acute myeloid leukemia
tup05223  Non-small cell lung cancer
tup05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tup05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102492738 (STAT3)
   04066 HIF-1 signaling pathway
    102492738 (STAT3)
   04068 FoxO signaling pathway
    102492738 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102492738 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102492738 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102492738 (STAT3)
   04062 Chemokine signaling pathway
    102492738 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102492738 (STAT3)
   04917 Prolactin signaling pathway
    102492738 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    102492738 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102492738 (STAT3)
   05206 MicroRNAs in cancer
    102492738 (STAT3)
   05205 Proteoglycans in cancer
    102492738 (STAT3)
   05203 Viral carcinogenesis
    102492738 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102492738 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102492738 (STAT3)
   05221 Acute myeloid leukemia
    102492738 (STAT3)
   05223 Non-small cell lung cancer
    102492738 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102492738 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102492738 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102492738 (STAT3)
  09172 Infectious disease: viral
   05162 Measles
    102492738 (STAT3)
   05161 Hepatitis B
    102492738 (STAT3)
   05160 Hepatitis C
    102492738 (STAT3)
   05163 Human cytomegalovirus infection
    102492738 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102492738 (STAT3)
   05169 Epstein-Barr virus infection
    102492738 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102492738 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102492738 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tup03000]
    102492738 (STAT3)
Transcription factors [BR:tup03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102492738 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 E2R135 DUF4795 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 102492738
NCBI-ProteinID: XP_006156071
LinkDB
Position
Un
AA seq 769 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGXXXXXFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGAAPYLKTKFICVTPTTCSNT
IDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
NT seq 2310 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagctacagcagctcgacacacggtacctggaacagctgcatcag
ctctacagcgacagttttccaatggagctacggcagtttctggccccttggattgagagt
caagattgggcatatgcagccagcaaagaatcacatgccactttggtgtttcataatctc
ttgggagagattgaccagcagtacagccgcttcctacaagagtccaatgtgctctaccag
cacaatctacggagaatcaagcaattccttcagagcaggtatcttgagaagccaatggag
attgcccggattgtggccaggtgcctttgggaagagtcccgcctcctccagactgctgcc
actgctgcccagcaaggggggcaggccaaccaccctaccgccgccgtggtgacggagaaa
cagcaaatgctggagcagcaccttcaggacgtgcggaagagagtgcaggatctagaacag
aaaatgaaagtggtagagaatctccaggatgactttgatttcaactataaaaccctcaag
agtcaaggagacatgcaggatctgaatggaaacaaccagtcagtgacccggcagaaaatg
cagcagcttgaacagatgctcactgcgctggaccagatgcggagaagcatcgtgagtgag
ctggcggggcttttgtcagcgatggagtatgtgcagaaaacgctcacagacgaggagctg
gctgactggaagaggcggcaacagattgcttgcattggaggccctcccaacatctgcctg
gatcgtctggaaaactggataacctcattagcagaatctcaacttcagacccgccaacaa
attaagaaactggaggagttgcagcaaaaagtttcctacaaaggggatcccatcgtccag
caccgaccaatgctggaggagagaatcgtggagctattccgaaatctaatgaaaagtgcc
ttcgtggtcgagcggcagccctgcatgcccatgcatcccgaccggcccttagtcatcaag
accggtgtccagttcactactaaagtcaggttactggtcaaattccctgagttgaattat
cagcttaaaattaaagtatgcattgacaaggactccggggacgtggcagctctccgagga
tcccggaaatttaacattctgggcacaaacacaaaagtgatgaacatggaagagtccaac
aatggcagcctctctgcagagttcaaacacttgaccctgagggagcagagatgtgggaat
gggggccgggccaattgtgacgcctccctgattgtgaccgaggagctacatctgatcacc
tttgagaccgaggtatatcatcaaggcctcaagattgacctagagacccattccctgccc
gtcgtggtgatctccaacatctgtcagatgcccaatgcctgggcatcgatcctgtggtat
aacatgctgaccaacaaccccaagaacgtgaacttcttcaccaagccccctattggaacc
tgggaccaagtggctgaggtcctgagctggcagttctcttccactacaaagcgaggcctg
agcatcgagcagttgaccacgctggcggagaagctcttggggcccggtgtgaactattca
ggctgtcagatcacatgggctaaattctgcaaagaaaacatggctggcaagggcttctcc
ttctgggtctggctggacaatatcatcgaccttgtgaaaaagtacatcctggccctttgg
aatgaagggtacataatgggctttatcagcaaggagcgggagcgggccatcctgagcacc
aagcccccaggnnnnnnnnnnnnnnnattcagtgaaagcagcaaagaaggaggagtcacc
ttcacttgggtggagaaggacatcagcggtaagacccagatccagtcggtggaaccatac
accaagcagcagctcaacaacatgtcatttgctgagatcatcatgggctataagatcatg
gatgccaccaacatcctggtgtcgccgctggtctatctctaccccgacattcctaaggag
gaggcatttggaaagtactgtcggccggagagccaggagcaccccgaggctgacccaggt
gccgccccatacctgaagaccaagtttatctgcgtgacaccaacgacctgcagcaatacc
attgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataatggt
gaaggtgcagaaccctcagcaggagggcagtttgagtccctcacattcgatatggagctg
acctcggagtgcgctacctctcccatgtga

DBGET integrated database retrieval system