KEGG   Tupaia chinensis (Chinese tree shrew): 102492959
Entry
102492959         CDS       T02978                                 

Gene name
AMY2A
Definition
(RefSeq) pancreatic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00500  Starch and sucrose metabolism
tup01100  Metabolic pathways
tup04970  Salivary secretion
tup04972  Pancreatic secretion
tup04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102492959 (AMY2A)
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    102492959 (AMY2A)
   04972 Pancreatic secretion
    102492959 (AMY2A)
   04973 Carbohydrate digestion and absorption
    102492959 (AMY2A)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     102492959 (AMY2A)
SSDB
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Other DBs
NCBI-GeneID: 102492959
NCBI-ProteinID: XP_006149558
LinkDB
Position
Un
AA seq 511 aa
MKFFLLLSAIGLCWAQYSPNTQTGRTSIVHLFEWRWVDIALECERYLAPNGFGGVQISPP
NENVVIYNPSRPWWERYQPISYKLCTRSGNEEQFRDMVTRCNNVGVRIYVDAVINHMCGN
GVSAGTSSTCGSYFNPGNRDFPAVPYSGWDFNDGKCKTSSGDIENYNDAVQVRDCRLVGL
LDLALEKDYVRSKVAEYMNYLIDIGVAGFRIDASKHMWPGDMKAVLDKLHNLNRSWFPEG
SKPFIYQEVIDLGGEPIKSSEYFGNGRVTEFKYGAKLGTVIRKWDGEKMCYLKNWGEGWG
FMPSDRALVFVDNHDNQRGHGAGGASILTFWDSRLYKMAVGFMLAHPYGVTRVMSSYRWP
RYFENGRDVNDWIGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQP
FTNWWDNGSNQVAFGRGNRGFIVFNNDDWQLSLTLQTGLPAGTYCDVISGDKIGSDCTGI
KIYVSNDGNAHFSISNSAEDPFIAIHVESKL
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgaagttctttctgctgctttcagccattgggctctgctgggctcagtattcccccaat
actcagactggtcgaacatctattgtccatctgtttgagtggcgctgggttgatattgct
cttgaatgtgaacgatacttggctcccaatggatttggaggtgttcagatctcaccaccc
aatgaaaatgttgtaatttataacccttcaagaccttggtgggaaagataccaaccgatt
agctataaattatgcacaagatctggaaatgaagagcaatttagagacatggtgactaga
tgtaacaatgttggcgtccgtatttatgtagatgctgtaattaatcatatgtgtggtaat
ggtgtgagtgcaggaacaagcagtacttgcggaagttacttcaatcctggcaatagagat
tttccggcagtcccttactctggttgggattttaatgatggtaaatgtaaaacttcaagt
ggagacattgagaattataatgatgctgttcaggtcagagattgtcgtctggttggtctt
cttgatcttgcactggaaaaagattatgtgcgttccaaggttgctgaatacatgaactat
ctcattgacattggtgtagcagggttcagaatcgatgcttccaagcacatgtggcctggg
gacatgaaggcagttttggataaactgcataatctgaatagaagttggttccctgaagga
agtaaacctttcatttaccaagaggtaattgatttgggtggtgagccaatcaaaagcagt
gagtacttcggaaatggccgtgtgacagaattcaagtatggtgcaaaactaggcacagtc
attcgcaagtgggatggagagaagatgtgttacttaaagaactggggagaaggttggggt
ttcatgccttctgacagagcacttgtctttgtggataaccatgacaatcaacgaggacat
ggagctggaggagcatctattcttacattctgggactctagactatataagatggctgtt
ggatttatgcttgctcatccttacggagttacacgagtgatgtcaagctatcgttggcca
agatattttgagaatggaagagatgttaatgactggattgggccaccaaataataatggg
gtaattaaagaagttactattaatccagacactacttgtggcaatgactgggtctgtgaa
catcgatggcgtcaaataaggaacatggtaattttccgtaacgtagttgatggccagcct
tttaccaactggtgggataatggtagcaaccaagtggcctttggaagaggaaacagaggg
tttattgtctttaacaatgatgactggcaattatcgttaactttacaaactggtcttcct
gctggcacatattgtgatgtcatttctggagataaaattggaagcgattgcacaggaatt
aaaatttatgtttccaatgatggcaatgctcatttttctattagtaactctgctgaagac
ccatttattgcaattcatgttgaatctaaattgtga

DBGET integrated database retrieval system