KEGG   Tupaia chinensis (Chinese tree shrew): 102493080
Entry
102493080         CDS       T02978                                 

Gene name
GRB2
Definition
(RefSeq) growth factor receptor bound protein 2
  KO
K04364  growth factor receptor-bound protein 2
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup01522  Endocrine resistance
tup04010  MAPK signaling pathway
tup04012  ErbB signaling pathway
tup04014  Ras signaling pathway
tup04062  Chemokine signaling pathway
tup04068  FoxO signaling pathway
tup04072  Phospholipase D signaling pathway
tup04150  mTOR signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04380  Osteoclast differentiation
tup04510  Focal adhesion
tup04540  Gap junction
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04630  JAK-STAT signaling pathway
tup04650  Natural killer cell mediated cytotoxicity
tup04660  T cell receptor signaling pathway
tup04662  B cell receptor signaling pathway
tup04664  Fc epsilon RI signaling pathway
tup04714  Thermogenesis
tup04722  Neurotrophin signaling pathway
tup04910  Insulin signaling pathway
tup04912  GnRH signaling pathway
tup04915  Estrogen signaling pathway
tup04917  Prolactin signaling pathway
tup04926  Relaxin signaling pathway
tup04935  Growth hormone synthesis, secretion and action
tup05034  Alcoholism
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05163  Human cytomegalovirus infection
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05203  Viral carcinogenesis
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05210  Colorectal cancer
tup05211  Renal cell carcinoma
tup05213  Endometrial cancer
tup05214  Glioma
tup05215  Prostate cancer
tup05220  Chronic myeloid leukemia
tup05221  Acute myeloid leukemia
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102493080 (GRB2)
   04012 ErbB signaling pathway
    102493080 (GRB2)
   04014 Ras signaling pathway
    102493080 (GRB2)
   04630 JAK-STAT signaling pathway
    102493080 (GRB2)
   04068 FoxO signaling pathway
    102493080 (GRB2)
   04072 Phospholipase D signaling pathway
    102493080 (GRB2)
   04151 PI3K-Akt signaling pathway
    102493080 (GRB2)
   04150 mTOR signaling pathway
    102493080 (GRB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102493080 (GRB2)
   04540 Gap junction
    102493080 (GRB2)
   04550 Signaling pathways regulating pluripotency of stem cells
    102493080 (GRB2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102493080 (GRB2)
   04660 T cell receptor signaling pathway
    102493080 (GRB2)
   04662 B cell receptor signaling pathway
    102493080 (GRB2)
   04664 Fc epsilon RI signaling pathway
    102493080 (GRB2)
   04062 Chemokine signaling pathway
    102493080 (GRB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102493080 (GRB2)
   04912 GnRH signaling pathway
    102493080 (GRB2)
   04915 Estrogen signaling pathway
    102493080 (GRB2)
   04917 Prolactin signaling pathway
    102493080 (GRB2)
   04926 Relaxin signaling pathway
    102493080 (GRB2)
   04935 Growth hormone synthesis, secretion and action
    102493080 (GRB2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102493080 (GRB2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102493080 (GRB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    102493080 (GRB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102493080 (GRB2)
   05206 MicroRNAs in cancer
    102493080 (GRB2)
   05205 Proteoglycans in cancer
    102493080 (GRB2)
   05203 Viral carcinogenesis
    102493080 (GRB2)
   05231 Choline metabolism in cancer
    102493080 (GRB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102493080 (GRB2)
   05225 Hepatocellular carcinoma
    102493080 (GRB2)
   05226 Gastric cancer
    102493080 (GRB2)
   05214 Glioma
    102493080 (GRB2)
   05221 Acute myeloid leukemia
    102493080 (GRB2)
   05220 Chronic myeloid leukemia
    102493080 (GRB2)
   05211 Renal cell carcinoma
    102493080 (GRB2)
   05215 Prostate cancer
    102493080 (GRB2)
   05213 Endometrial cancer
    102493080 (GRB2)
   05224 Breast cancer
    102493080 (GRB2)
   05223 Non-small cell lung cancer
    102493080 (GRB2)
  09165 Substance dependence
   05034 Alcoholism
    102493080 (GRB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102493080 (GRB2)
   05160 Hepatitis C
    102493080 (GRB2)
   05163 Human cytomegalovirus infection
    102493080 (GRB2)
   05165 Human papillomavirus infection
    102493080 (GRB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102493080 (GRB2)
   01522 Endocrine resistance
    102493080 (GRB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tup04131]
    102493080 (GRB2)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:tup04990]
    102493080 (GRB2)
Membrane trafficking [BR:tup04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    102493080 (GRB2)
Domain-containing proteins not elsewhere classified [BR:tup04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   102493080 (GRB2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_10 SH3_3 DUF5093 hSH3 SH3_4
Other DBs
NCBI-GeneID: 102493080
NCBI-ProteinID: XP_006145876
LinkDB
Position
Un
AA seq 217 aa
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPW
FFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGIDVQHFKVLRDGAGKYFL
WVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRG
DFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV
NT seq 654 nt   +upstreamnt  +downstreamnt
atggaagccatcgccaaatatgacttcaaagccactgcagacgatgagctgagcttcaaa
aggggggacatcctcaaggttttgaatgaagaatgtgatcagaactggtacaaggcagag
ctcaatgggaaggatggcttcatccccaagaactacatagagatgaaaccacatccgtgg
ttttttggcaaaatccccagagccaaggcagaagaaatgcttagcaaacagcggcacgac
ggggcctttctcatccgagagagcgagagtgctcccggggatttctccctgtctgtgaag
tttgggattgacgtgcagcacttcaaggtgctccgagatggagctggaaaatatttcctc
tgggtggtgaagttcaattctttgaatgagctggtagattatcacagatccacatccgtc
tccagaaaccagcagatatttctgcgggatatagaacaggtgccacagcagccgacgtac
gtccaggccctctttgactttgacccccaggaggatggcgagctgggcttccgtcgggga
gactttatccacgtcatggataactcagaccccaactggtggaaaggagcttgccacggg
cagacgggcatgtttccccgcaattacgtcacccctgtgaaccggaacgtctaa

DBGET integrated database retrieval system