KEGG   Tupaia chinensis (Chinese tree shrew): 102493360Help
Entry
102493360         CDS       T02978                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00010  Glycolysis / Gluconeogenesis
tup00053  Ascorbate and aldarate metabolism
tup00071  Fatty acid degradation
tup00280  Valine, leucine and isoleucine degradation
tup00310  Lysine degradation
tup00330  Arginine and proline metabolism
tup00340  Histidine metabolism
tup00380  Tryptophan metabolism
tup00410  beta-Alanine metabolism
tup00561  Glycerolipid metabolism
tup00620  Pyruvate metabolism
tup01100  Metabolic pathways
Module
tup_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102493360 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    102493360 (ALDH2)
   00620 Pyruvate metabolism
    102493360 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102493360 (ALDH2)
   00561 Glycerolipid metabolism
    102493360 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102493360 (ALDH2)
   00310 Lysine degradation
    102493360 (ALDH2)
   00330 Arginine and proline metabolism
    102493360 (ALDH2)
   00340 Histidine metabolism
    102493360 (ALDH2)
   00380 Tryptophan metabolism
    102493360 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102493360 (ALDH2)
Enzymes [BR:tup01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     102493360 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 102493360
NCBI-ProteinID: XP_006148056
LinkDB All DBs
Position
Un
AA seq 525 aa AA seqDB search
MQDSGVSLQPISSLTQKPALGLQSCTERVCCNSADGTVNTFPQSAHIFIDNEWHDAISKK
TFPTVNPSTGEVICQVAAGDKEDVDKAVKAARAAFQLGSPWRRMDASDRGRLLYRLADLI
ERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTR
HEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPP
GVVNIVPGFGPTAGAAIASHDDVDKVAFTGSTEVGHLIQIAAGKSNLKRVTLELGGKSPN
IIMSDADMAWAVEQAHFALFFNQGQCCCAGSRTYVQEDVYAEFVERSVARAKSRVVGNPF
DSQTEQGPQVDETQFKKILGYIQSGKQEGAKLLCGGGPAADRGYFIQPTVFGDVQDGMTI
AKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNC
YDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacagcggagtcagcctccaacccatcagttctcttacacagaagcctgccctg
ggtttgcaaagctgcacggagagggtttgctgcaacagtgctgacggaacagtgaacacg
tttcctcaaagtgcacatatcttcatagacaatgagtggcatgatgccatcagcaagaaa
acattccccactgttaatccgtccactggagaggtcatctgccaggtggctgcaggggac
aaggaagatgtggacaaggcagtgaaggccgcccgggctgccttccagctaggctcaccc
tggcgccgcatggatgcatctgacaggggccggctgctgtaccgcctggctgatctgatt
gagcgggaccggacctacctggcagccttggagaccttggacaacggcaagccctatgtc
atttcctatctggtagatttggacatggtcctcaaatgtctccggtattatgctggctgg
gctgataaataccatgggaaaaccattcccatcgatggggacttcttcagctatacccgc
catgaacccgtgggggtgtgtgggcagatcattccgtggaacttccccctcctgatgcaa
gcgtggaaactgggcccagccttggcgactggaaatgtggttgtgatgaaagtagctgag
cagacgcccctcaccgccctgtatgtggccaacctgatcaaggaggccggctttccccct
ggcgtggtcaatattgttcctggatttggtcctactgccggggctgctatcgcctcccat
gatgatgtggacaaggtggcgttcacaggctccactgaggtcggccacctcatccagatt
gctgcagggaagagtaatctcaagagggtgacgctggagctggggggcaagagccccaac
ataatcatgtcggacgctgacatggcctgggctgtggagcaggcccactttgccctgttc
ttcaatcagggccagtgctgttgtgccggctctcggacctatgtacaggaggatgtgtat
gctgagttcgtggagcggagcgtggcccgggccaagtcacgggtggtcgggaaccccttt
gacagccagactgagcaggggccccaggtagatgaaactcagtttaagaagatccttggc
tacatccaatctgggaagcaagagggggcgaagctgctgtgtggtggggggcctgctgcc
gaccgtggttacttcatccagcctactgtgtttggagatgtgcaagatggcatgaccatc
gccaaggaggagatctttgggccagtgatgcagatcctgaagttcaagaccatagaggag
gttgtcgggagagccaacaattccaaatatgggctggctgcagctgtcttcaccaaggac
ttggacaaggccaattatctgtcccaagccctgcaggctggcactgtgtgggtcaactgc
tatgatgtgtttggcgcccagtcaccatttggcggctataagatgtcgggcagtggccgg
gagctgggggagtacgggctgcaggcatacactgaagtgaagaccgtcacagtcaaagtt
cctcagaagaactcgtag

DBGET integrated database retrieval system