KEGG   Tupaia chinensis (Chinese tree shrew): 102493365Help
Entry
102493365         CDS       T02978                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00010  Glycolysis / Gluconeogenesis
tup00051  Fructose and mannose metabolism
tup00052  Galactose metabolism
tup00500  Starch and sucrose metabolism
tup00520  Amino sugar and nucleotide sugar metabolism
tup00524  Neomycin, kanamycin and gentamicin biosynthesis
tup01100  Metabolic pathways
tup01200  Carbon metabolism
tup04066  HIF-1 signaling pathway
tup04910  Insulin signaling pathway
tup04930  Type II diabetes mellitus
tup04973  Carbohydrate digestion and absorption
tup05230  Central carbon metabolism in cancer
Module
tup_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tup_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102493365 (HK1)
   00051 Fructose and mannose metabolism
    102493365 (HK1)
   00052 Galactose metabolism
    102493365 (HK1)
   00500 Starch and sucrose metabolism
    102493365 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    102493365 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102493365 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    102493365 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102493365 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102493365 (HK1)
 09160 Human Diseases
  09161 Cancers
   05230 Central carbon metabolism in cancer
    102493365 (HK1)
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    102493365 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tup04131]
    102493365 (HK1)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     102493365 (HK1)
Membrane trafficking [BR:tup04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    102493365 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 102493365
NCBI-ProteinID: XP_006148992
LinkDB All DBs
Position
Un
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFKKEMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSFFRILRVQVNHEKNQNVHMESEVYDTPENIMH
GSGSQLFDHVAECLGDFMEKKNIKDKKLPVGFTFSFPCRQSKIDEAILITWTKRFKASGV
EGADVVKLLDKAIKKRGDYEANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YLGELVRLILVKMAKEGLLFEGRITPELLTKGKFNTSDVSAIEKNKEGLHNAKEILTRLG
VEPSDDDCISVQHVCTIVSFRSANLVATTLGAILNRLHDNKGMPRLRTTVGVDGSLYKTH
PQYARRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFRLT
KDMLLEVKRRMRTEMELGLRKQTHDDAVVKMLPSFVRSTPDGTEHGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYAIPVEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGF
TFSFPCKQTNLDVGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMLEGTEGRMCINMEWGAFGDNGCLDD
IRTEYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPLKTRG
IFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAA
VVDKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKG
AALITAVGVRLRAEASS
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcgcagctcctggcctattacttcaccgagctgaaggatgaccaagtcaaa
aagattgacaagtatctttatgccatgcggctctccgatgaaactctgatagatatcatg
actcgcttcaagaaggagatgaagaatggcctctcccgggattttaatccaacagccaca
gtcaagatgttgccaacgtttgtaaggtctattcccgacggttctgaaaagggggatttc
attgccctggatcttggtgggtctttcttccgaattctacgggtgcaagtgaatcatgag
aaaaaccagaatgttcacatggaatccgaggtttatgacaccccagagaacatcatgcat
ggcagtggaagccagcttttcgatcatgttgctgagtgcctgggagacttcatggagaaa
aagaatatcaaggacaagaaattacctgtgggcttcacgttttctttcccttgccgacaa
tccaagatagacgaggccatcctcatcacctggacgaagcgatttaaagcgagcggtgtg
gaaggagcagatgtggtcaagttgcttgacaaagccatcaaaaagcgaggggactatgaa
gccaacatcgtcgcggtggtaaatgacactgtggggaccatgatgacctgtggctatgat
gaccagcattgtgaagtcggcctgatcattggcacgggcaccaacgcttgctacatggag
gaactgcggcacattgacctggtggaaggagacgaggggaggatgtgtatcaacactgaa
tggggagccttcggggacgatgggtctctggaagacatccggaccgagtttgacagagag
atagaccggggctccctcaaccccggaaaacagctgtttgagaagatggtcagtggtatg
tacctgggggagctggttcgactgatcctagtaaagatggccaaggagggcctcttattt
gaagggcggatcaccccagagctgctcaccaaagggaagtttaataccagtgatgtatca
gccatcgaaaagaataaggaaggcctccacaatgccaaagaaatcctgacccgcctggga
gtggagccatcagatgatgactgtatctcagtccagcacgtgtgcaccatcgtctccttt
cgctcggctaacctcgtggctaccacgttgggtgccatcttgaaccgcctgcatgataac
aagggcatgcccaggctgcggaccacggttggtgtcgacggatctctttacaagacgcac
ccacagtatgcccggcgttttcacaagaccctgaggcgcttggtgccagactccgacgtc
cgtttcctcctctcggagagtggcagcggcaagggggccgccatggtgacggcggtggcc
taccgcctggctgagcagcaccggcagattgaggagaccctggcccacttccgcctcacc
aaggacatgctgctggaggtgaagaggaggatgcggactgagatggagctggggctgagg
aagcagacgcacgacgatgctgtggtcaagatgctgccttccttcgtccggagcacccca
gatggcactgaacatggtgacttcttggccctggatctcggaggaacgaatttccgtgtc
ctgctggtgaagatacgtagcgggaaaaagagaacggtggaaatgcacaacaagatctat
gccatccctgtggagatcatgcagggcaccggcgaagagctgtttgaccacatcgtctcc
tgcatctctgacttcctggactacatggggatcaaaggccccaggatgcctctgggcttc
acattctcattcccctgcaagcagacgaatctggatgtgggcatcttgatcacctggacc
aagggttttaaggctactgactgtgtggggcatgatgtcgtcaccttactaagggatgcc
ataaaaaggagagaggaatttgacctggacgtggtggctgtggtcaacgacacggtgggc
accatgatgacctgtgcttacgaggagcccacctgtgaggttggactcattgtagggacg
ggcagcaatgcctgctacatggaggaaatgaagaacgtagagatgctggaggggaccgag
ggccgaatgtgtatcaacatggaatggggagcctttggggacaatggctgtctggatgac
atcagaacggagtatgacagattggtggacgaatattccctaaatgcagggaagcaaaga
tatgagaagatgatcagtggcatgtacctgggggagatcgtccgcaacatcttgatcgac
ttcaccaagaagggattcctcttccgggggcagatctctgagccgctgaagacccggggc
atcttcgagaccaaatttctctctcagatcgagagtgaccgactagcgctgctccaggtc
cgggccatcctccagcagctgggtctgaacagcacctgtgacgacagtatcctggtcaag
accgtgtgcggggtggtgtccaagagggctgcacagctgtgcggtgccggcatggcggcg
gtagtggacaagatccgcgagaacagagggctggaccatctgaacgtgacggtgggcgtc
gatgggacgctctacaagcttcatccgcatttctccagaatcatgcaccaaaccgtgaag
gaactgtcaccaaagtgtaatgtgtccttcctcctgtccgaagacggtagtggcaagggg
gccgccctcatcacagccgtgggcgttcggctccgagcagaagcgagcagctaa

DBGET integrated database retrieval system