KEGG   Tupaia chinensis (Chinese tree shrew): 102494934
Entry
102494934         CDS       T02978                                 

Gene name
BRCA1
Definition
(RefSeq) BRCA1, DNA repair associated
  KO
K10605  breast cancer type 1 susceptibility protein [EC:2.3.2.27]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01524  Platinum drug resistance
tup03440  Homologous recombination
tup03460  Fanconi anemia pathway
tup04120  Ubiquitin mediated proteolysis
tup04151  PI3K-Akt signaling pathway
tup05206  MicroRNAs in cancer
tup05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102494934 (BRCA1)
  09124 Replication and repair
   03440 Homologous recombination
    102494934 (BRCA1)
   03460 Fanconi anemia pathway
    102494934 (BRCA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102494934 (BRCA1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    102494934 (BRCA1)
  09162 Cancer: specific types
   05224 Breast cancer
    102494934 (BRCA1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102494934 (BRCA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tup01009]
    102494934 (BRCA1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:tup04121]
    102494934 (BRCA1)
   03036 Chromosome and associated proteins [BR:tup03036]
    102494934 (BRCA1)
   03400 DNA repair and recombination proteins [BR:tup03400]
    102494934 (BRCA1)
Enzymes [BR:tup01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102494934 (BRCA1)
Protein phosphatases and associated proteins [BR:tup01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102494934 (BRCA1)
Ubiquitin system [BR:tup04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    102494934 (BRCA1)
  Multi subunit Ring-finger type E3
   BRCC complex
    102494934 (BRCA1)
Chromosome and associated proteins [BR:tup03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     102494934 (BRCA1)
DNA repair and recombination proteins [BR:tup03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-core complex
     102494934 (BRCA1)
    BRCA1-A complex
     102494934 (BRCA1)
    BRCA1-B complex
     102494934 (BRCA1)
    BRCA1-C complex
     102494934 (BRCA1)
    BRCA complex
     102494934 (BRCA1)
   FA (Fanconi anemia) pathway
    Downstream FA components
     102494934 (BRCA1)
SSDB
Motif
Pfam: BRCT_assoc BRCT zf-C3HC4 zf-C3HC4_2 zf-C3HC4_4 zf-C3HC4_3 zf-RING_UBOX zf-RING_2 zf-RING_5 zf-Nse zf-RING_6 zf-ANAPC11 zf-RING_10 Prok-RING_4 zf-rbx1 MecA_N
Other DBs
NCBI-GeneID: 102494934
NCBI-ProteinID: XP_006156147
LinkDB
Position
Un
AA seq 1807 aa
MDLSSVHVEEVQNVLNAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQ
CPLCKNDITRRSLQESTRFSQLVEELLKIIHAFELDTGLQFTTSYSFSKKENNSPEQLKE
EVSIVQSMGFRNRAKRLRQGELEDPTLQEASLSVQLSNLGIVRSLRTKQQMQPQNKSVYI
ELGSDSSEDTVNKTSYCSAKDQELLQITPQGARIEASLDSAKNAACEFSKKDITDTEHHQ
SSNKDLNTTEKHATERHTEKYQGISVSNLHVEPCGINTHASSLQHENSSLLLTKDRMNVE
KAELCNKSQQPDLARSQQSRWTENKETCNDRQIPSTEKKVDLNADPLCGKKKQAKQKPVC
SNSPRDDQDSPWITLNSSIQKVNEWFSRSDEMLTSNDSHDGESEIAGAFEVPNKVDEYSG
SSEKIDLMANDPHDALVSKSEGIYSKPVEGNIEDKIFGKTYRRKASLPNLSRVTDDLIRG
AFVTEPEITRERPFTNKLKRKRRTISGLHPEDFIKKTDLPVVQKTPEKINQRTDQIERNG
QVVSIADSGNENETKSDYIPKEKNANPMESLEKESALRTKAEPISSSVSNVELEINNHSS
EAPKKNRLRRKFSARHIRTLELIGNKSPSPPNRTELQIDSYSSSEERTKKGEQMPVGHSR
KFQLGEEKEPTTGAKKNNQPNTEISERRASGVIPDLKLTNIPGFFTNSLSSNKLPEFVHR
SLQREKVEENQETIQASSSTKDLVLRGERGLQDVRSAESTSISLVPDTDDGTQDSISLLD
TNPLARKAKTAPNQCVNQSETTENPKELIHSCSKITRNEGFKDPLKREVNLIQEMSVEME
ESELDTQYLQNTFKSSKRQSFALSSNPGNPEKEHVCVKEESLKESNIKHIQAVSTTVFQK
DKLGDFAKSGIKEVPRLCPSSQFRGNETDLITANKPEVSQNPYHMPLLYPVKSPIITKSK
KNLSEEGFEEHAMLLERAMENENIIQSTVSTISQDNIREGAFKEASSSSINEIGPSTNEG
SSSINEVGSSGENVQAELGKKRGSKLNAVLRLGLMQPEVYKQSLPLSNRNDPETKRQEKN
EGGVQAIKDLPPCLISANLEQPMESSHASQICSETPDDLLDDDEGKENSFAEVDVKERSA
VFGKTVQRRELRRSSSPLTRACLAEGQQTGAQKLDSSENLSSEDEELPCFQHLLFGKVNG
TPQSTRHSTVAAECLSKKTEEDLVALKNSLNDCNDQEILTKTSQEHYLSEEAKYSVSLFS
SQYSVLEDVTTNKNTQDPFLMLYPPSKQMRPCSENQEVVLSDKELISDDEEREPGLEDDY
QEEQSLDSNLGEAASEYESETNLSEDCSGLSSQSDILTTQQRDTMQDNLIKLKQEMAELE
AVLEQQGSQASNSSLSLVADSCDSDPEDLLNPEQNTSPKAELTSEKSNEYPVSLNPKNLS
ANKLQGSPESSTSKNKEPEVKRSRNCLSQEGLVKVVDVEEQQLEKSGPHDLKEKTYLPRQ
DLEGSPYLESGISLFSDDPEFDPPEKRAPEPAHVYNMPASISTLKSSQLQGADSAKSPAA
ARTTNTAGDAVREESKSRENPELTSSAERVGKRISMVVSGLTPKESMLVQKFARKNHIAF
TNAVTKETTHVIMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKEKKMLDEHAFEV
RGDIINGRNHQGPKRARESPNRKIFKGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELS
CFSVGTGAHPVVVVQPDAWTEDDGFHAIGQLCEAPVVTREWVLDSVALYQCQELDTYLVP
QIPQSRC
NT seq 5424 nt   +upstreamnt  +downstreamnt
atggatttatcttcagttcacgttgaagaagtacaaaatgtccttaacgctatgcagaag
atcttagaatgtccaatctgtctggagctgatcaaggaacctgtttctacaaagtgtgac
cacatattttgcaagttttgtatgctgaaacttctcaaccagaagaaagggccttcacag
tgtcctttgtgtaagaatgatataaccagaagaagcctacaagaaagtacaagatttagt
caacttgttgaagagctgttgaaaatcattcatgcttttgaacttgatacaggattgcag
tttacaaccagttacagcttttcaaaaaaggaaaataactctcctgaacagctaaaggag
gaagtttctatcgtccaaagcatgggcttccgaaaccgtgccaaaagacttcgacagggc
gaacttgaagatcctaccttgcaggaagccagccttagtgtccaactctctaaccttgga
attgtgagatctctgaggacaaagcaacagatgcagcctcaaaataagtctgtctacatt
gaactgggatctgattcttctgaagatacagttaataagacaagttattgcagtgcaaaa
gaccaagaattgttacaaatcactcctcaaggagccagaattgaagccagcttggattct
gcaaaaaacgctgcttgtgagttttctaagaaggacataacagatactgaacatcatcaa
tccagtaataaagatctgaacaccactgagaagcatgcaactgagaggcatacagaaaag
tatcagggtatttctgtttcaaacttgcatgtggagccatgtggcataaatactcatgcc
agctcattacagcatgagaacagcagtttattactcactaaggacagaatgaatgtagaa
aaggctgaattgtgtaataaaagccaacaacctgacttagcaaggagccagcagagcaga
tggactgaaaataaggaaacatgtaatgataggcagattcccagcacagaaaaaaaggta
gatctaaatgctgatcccctgtgtggaaagaaaaaacaagctaagcagaaacctgtatgt
tctaacagtcctagagatgaccaagattctccttggataactctaaatagtagcattcag
aaagttaatgagtggttttccagaagtgatgaaatgttaacttctaacgactcacatgat
ggtgagtctgaaatagctggtgcattcgaagttccaaataaagtagatgaatattctggt
tcttcagaaaaaatagacttaatggccaacgatcctcatgatgctttagtaagtaaaagt
gaaggaatctactccaaaccagtagagggtaatattgaagataaaatttttgggaaaacc
tatcggaggaaagcaagtcttcctaacttgagccgtgtaactgatgatctaattagaggg
gcatttgttacagagcctgagataactcgagagcgtcccttcacaaataaattaaagcgt
aaaaggagaactatatcaggccttcatcctgaagattttatcaagaaaacagatttgcca
gttgttcaaaagactcctgaaaagataaatcagagaactgaccaaatagagcgtaatggt
caggtggtgagtattgctgatagtggtaatgagaatgaaacaaaaagtgattatatcccg
aaagagaaaaatgctaacccaatggaatcattagaaaaagaatctgctctcagaactaaa
gctgagcccataagcagcagtgtaagcaatgtggaactagaaataaataaccacagttca
gaagcacctaagaagaataggctgaggaggaagttctctgctaggcatattcgcacactt
gaactaataggcaataaaagtccaagcccacctaatcgtactgaactacaaattgacagt
tattctagcagtgaagagagaacgaaaaagggtgagcaaatgccagttggacacagcaga
aagtttcaacttggggaagagaaagaacctacaactggagccaagaaaaataaccagcca
aatacagaaataagtgaaagacgtgccagtggtgttatcccagatctgaagttaacaaac
atacctggtttttttacaaactctttgagttctaataaacttccagaatttgtccatcgt
agccttcaaagagaaaaagtagaagagaaccaagaaacaattcaagcatccagtagtacc
aaagatctggtattaaggggagaaaggggtttgcaagatgtaaggtctgcagagagtacc
agtatttctttggtacctgatactgacgatggcacccaagatagcatctcattactagat
actaaccccttagctaggaaggcaaaaacagcaccaaatcaatgtgtgaatcagagtgag
acaactgaaaaccccaaggaacttatacacagttgttccaaaattactaggaatgaaggc
ttcaaggatccattgaaacgtgaagttaatcttattcaggagatgagtgtagaaatggag
gagagtgaacttgatactcagtatttacagaatacattcaagagttcaaagcgtcagtca
tttgctctgtcttcaaatccaggaaatccagaaaaggaacatgtctgtgttaaagaagaa
agtctgaaagagtctaacatcaaacatatacaggcagttagtaccacggtttttcagaaa
gataagctaggtgattttgctaaatctggcattaaagaagtccctagactttgtccatca
tctcagttcagaggcaatgaaactgatctcattactgcaaataaacctgaagtttcacaa
aacccgtatcatatgccattactttatcctgtcaagtcacctattataactaaaagtaag
aaaaacctgtcagaggaagggtttgaggaacatgcaatgttacttgaaagagcaatggaa
aatgagaacatcattcaaagtacagtgagcacaattagccaagataacattagagaaggt
gcttttaaagaagccagctcaagcagtattaatgaaataggtcctagtactaatgaagga
agctctagtattaatgaggtgggttccagtggtgaaaacgttcaagcagaactaggtaaa
aagagaggatctaaattaaatgctgtgcttagattaggtcttatgcaacccgaagtctat
aagcaaagtcttcctttaagtaatcgtaatgatcctgaaacaaaaagacaagaaaaaaat
gaaggaggagttcaggctattaaagatttacctccatgtctaatttcagctaatctagag
caacctatggaaagtagccatgcttctcagatttgttctgagacacctgatgatctgtta
gatgatgatgaaggaaaagaaaatagctttgctgaggttgatgttaaggaaagatctgct
gtttttggcaaaactgtccagagaagagagttaagaaggagctctagccctttaacccgt
gcatgtttggctgagggtcagcaaacaggagctcagaaattagattcatcagagaaccta
tctagtgaggatgaagaacttccctgcttccaacacttattatttggtaaagtaaatggc
acacctcagtctaccagacatagcactgttgctgcagagtgtttatctaagaaaacagag
gaggacctagtagcattgaaaaatagcttaaatgactgcaatgaccaggaaatactgaca
aagacatcccaggaacattaccttagtgaggaagcaaagtattctgttagtttattttcc
tcacagtacagtgtattagaagacgtgacgacaaataagaatacacaggatcccttcttg
atgctttatcctccttccaaacaaatgaggccgtgctctgaaaaccaggaagttgttctg
agtgacaaggaattgatttcagatgatgaagaaagggaacctggcctggaagatgattac
caagaagagcagagtttggattcaaacttaggtgaagcagcatctgagtatgaaagtgaa
acaaatctctctgaagactgctcaggactatcctctcagagtgatattttaaccactcag
cagagggataccatgcaagataacctgataaagctcaagcaggaaatggcagaactagaa
gctgtgttagagcagcaggggagccaggcttctaacagctccctttcactggtagctgac
tcttgtgactccgaccccgaggatctcctaaatccagaacaaaacacatcaccaaaagca
gaattaacttcagagaaaagtaatgaatatcctgtaagcctgaatccaaaaaacctttct
gctaacaagttgcaaggatctccagagagttccactagtaaaaataaagagccagaagtg
aaaaggtctagaaactgcttgtctcaagaggggctcgttaaggttgttgatgtagaggag
caacaactggaaaagtctggaccacatgatttaaaggagaagacttacttgccaagacaa
gatctagaaggaagcccttacctggaatctggaatcagtctcttctctgatgaccctgaa
tttgatccccctgaaaagagagccccagagccagctcatgtttacaacatgccagcttcc
atctctacattgaaatcatcccaacttcaaggtgcagattctgccaagagtccagctgct
gctcgtactactaatactgctggagacgctgtgagggaagaaagcaagagcagggagaat
ccagaactgacatcttcagcagaaagagtcggcaaaagaatatccatggtggtgtcgggc
ttgaccccaaaagaatctatgcttgtgcagaagtttgccagaaaaaaccacattgctttt
actaatgcagttactaaagaaactactcatgtcattatgaaaacggatgctgagtttgtg
tgtgaacggacactgaaatattttctgggaattgcaggaggaaaatgggtagttagctat
ttctgggtgacccagtctattaaagaaaaaaagatgctggatgagcacgcttttgaagtc
agaggagatatcatcaatggaagaaaccaccaaggtccaaagcgagcaagagaatccccg
aacagaaagatcttcaagggcctagaaatttgttgctatggacccttcaccaacatgccc
acagatcagctggagtggatggtgcagctgtgtggggcttcagtggtgaaggagctttcc
tgtttcagcgttggcacaggtgctcacccagttgtggtcgtgcagccagacgcctggaca
gaggacgatggcttccatgcaattgggcagttgtgtgaagcacctgtggtgacacgagaa
tgggtattggacagcgtagccctctaccagtgccaggagctggacacctacctggtaccc
cagatcccccagagccgctgctga

DBGET integrated database retrieval system